KEGG   Bacillus subtilis subsp. subtilis 168: BSU01360
Entry
BSU01360          CDS       T00010                                 

Symbol
secY
Name
(RefSeq) protein translocase subunit SecY
  KO
K03076  preprotein translocase subunit SecY
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
bsu03060  Protein export
bsu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU01360 (secY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU01360 (secY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU01360 (secY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU01360 (secY)
Secretion system [BR:bsu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BSU01360 (secY)
SSDB
Motif
Pfam: SecY
Other DBs
NCBI-GeneID: 936779
NCBI-ProteinID: NP_388017
Pasteur: BG10445
BSORF: BG10445
UniProt: P16336 A0A6M4JEQ4
Position
144527..145822
AA seq 431 aa
MFKTISNFMRVSDIRNKIIFTLLMLIVFRIGAFIPVPYVNAEALQAQSQMGVFDLLNTFG
GGALYQFSIFAMGITPYITASIIIQLLQMDVVPKFTEWSKQGEVGRRKLAQFTRYFTIVL
GFIQALGMSYGFNNLANGMLIEKSGVSTYLIIALVLTGGTAFLMWLGEQITSHGVGNGIS
IIIFAGIVSSIPKTIGQIYETQFVGSNDQLFIHIVKVALLVIAILAVIVGVIFIQQAVRK
IAIQYAKGTGRSPAGGGQSTHLPLKVNPAGVIPVIFAVAFLITPRTIASFFGTNDVTKWI
QNNFDNTHPVGMAIYVALIIAFTYFYAFVQVNPEQMADNLKKQGGYIPGVRPGKMTQDRI
TSILYRLTFVGSIFLAVISILPIFFIQFAGLPQSAQIGGTSLLIVVGVALETMKQLESQL
VKRNYRGFMKN
NT seq 1296 nt   +upstreamnt  +downstreamnt
ttgtttaaaacaatctccaactttatgcgtgtgagtgatatcaggaataaaatcatattc
actttactcatgcttatcgtctttcgcataggtgcgtttattcctgtgccttacgttaac
gctgaagcgttacaggcacagtctcaaatgggtgtttttgatctccttaatacatttggc
ggcggtgcgctttaccaattttccattttcgcaatgggaattactccttatatcacggct
tcgatcatcattcagctgcttcagatggatgtggtaccgaagtttaccgagtggtctaag
caaggtgaagttggccgccgtaaattagctcagttcacaaggtactttacgattgtgctt
ggtttcatccaagcgttaggtatgtcatatggattcaacaatctggcaaacggtatgctg
atcgaaaaatccggtgtatcgacatatcttatcattgctttagtgctcactggcggaact
gcctttttaatgtggcttggggaacaaattacttctcatggagtaggcaacggaatatcg
atcattatcttcgcggggattgtgtctagtattccaaaaacaattgggcaaatatatgag
actcaatttgtcggcagcaacgatcagttgtttattcatattgtgaaagtcgcacttctt
gtgattgcgattttagcagttattgttggagttattttcattcagcaagccgtacggaaa
attgcgattcaatatgctaaaggcacaggtcgttcacctgctggcggaggtcagtctaca
caccttccattgaaagtgaatcctgcaggggttattccggtaatctttgcggttgcgttt
ttgataacgccgcggacgatcgcgtcattctttggaacaaacgatgtgacaaagtggatt
caaaacaactttgataatacgcatccggtgggtatggcgatatatgttgcgttgattatt
gcctttacgtacttttatgcttttgtacaggtaaaccctgaacaaatggctgataacctt
aaaaaacagggtggctatatcccgggggttcgtccagggaaaatgactcaagatagaatt
acgagcattttgtatcgacttacgtttgtgggttctatattcttagccgtgatttccatt
cttcctatctttttcattcaattcgctggattgcctcaaagtgcacaaattggcggaaca
tctttgttaattgttgtcggggtagccttggagacaatgaaacaactagaaagccagttg
gtgaaacgaaactaccgtggatttatgaaaaactag

DBGET integrated database retrieval system