KEGG   Bacillus subtilis subsp. subtilis 168: BSU01370
Entry
BSU01370          CDS       T00010                                 

Symbol
adk
Name
(RefSeq) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU01370 (adk)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU01370 (adk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU01370 (adk)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     BSU01370 (adk)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU01370 (adk)
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_33 AAA_18 Hydin_ADK
Other DBs
NCBI-GeneID: 938508
NCBI-ProteinID: NP_388018
Pasteur: BG10446
BSORF: BG10446
UniProt: P16304 A0A6M3Z795
Structure
Position
145877..146530
AA seq 217 aa
MNLVLMGLPGAGKGTQGERIVEDYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVP
DEVTIGIVKERLGKDDCERGFLLDGFPRTVAQAEALEEILEEYGKPIDYVINIEVDKDVL
MERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADDNEETVSKRLEVNMKQTQ
PLLDFYSEKGYLANVNGQQDIQDVYADVKDLLGGLKK
NT seq 654 nt   +upstreamnt  +downstreamnt
atgaacttagtcttaatggggcttcctggtgccggtaaaggcacacagggcgaacgaatt
gttgaggattatgggattcctcatatctcaacaggagatatgttccgtgctgctatgaaa
gaagaaacaccactcggactcgaagcaaaatcttatattgataagggagagctcgtacct
gacgaagtcacaatcggaattgtaaaagagagacttggcaaagatgattgtgaaagaggt
tttcttctggacggatttccgcgaacagtcgctcaagccgaagctcttgaagaaattctt
gaggaatacggcaagccgattgattatgtcattaacattgaagtcgacaaagatgttctg
atggaacgtctgactggacgcagaatttgcagtgtttgcggcacaacctatcatttagtc
tttaatccgccgaaaacgccgggtatttgtgataaagacggaggcgaactctatcaacgg
gcagatgataatgaggaaacagtctctaaacggcttgaggtaaacatgaagcaaactcag
cctttactcgatttctattcagagaaaggttatcttgcaaacgtgaatggccagcaggac
attcaagacgtttatgcagatgtgaaggatcttcttggaggattaaaaaaatga

DBGET integrated database retrieval system