KEGG   Bacillus subtilis subsp. subtilis 168: BSU01420
Entry
BSU01420          CDS       T00010                                 

Symbol
rpsK
Name
(RefSeq) 30S ribosomal protein S11
  KO
K02948  small subunit ribosomal protein S11
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01420 (rpsK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01420 (rpsK)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU01420 (rpsK)
  Bacteria
    BSU01420 (rpsK)
  Archaea
    BSU01420 (rpsK)
SSDB
Motif
Pfam: Ribosomal_S11 3HCDH_RFF
Other DBs
NCBI-GeneID: 938926
NCBI-ProteinID: NP_388023
Pasteur: BG10731
BSORF: BG10731
UniProt: P04969 A0A6M4JC54
Position
148359..148754
AA seq 131 aa
MAAARKSNTRKRRVKKNIESGIAHIRSTFNNTIVTITDTHGNAISWSSAGALGFRGSRKS
TPFAAQMAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVTPVPH
NGCRPPKRRRV
NT seq 396 nt   +upstreamnt  +downstreamnt
atggctgctgctcgtaaatctaacacgcgtaaacgtcgcgtgaaaaagaatattgagtct
ggaattgctcatattcgttcaactttcaataacacgatcgttacgatcactgacactcat
ggtaatgctatttcttggtctagtgccggagctttaggattcagaggttctcgtaaatct
actccttttgctgcgcaaatggctgcagaaacagctgctaaaggttcaatcgaacatggt
cttaaaactctagaggttactgttaaaggacctggttcaggccgtgaagctgcaatccgt
gcacttcaagctgctggactagaagtcactgctatcagagacgtaactcctgttcctcat
aacggatgccgtccaccaaaacgtcgccgcgtgtaa

DBGET integrated database retrieval system