KEGG   Bacillus subtilis subsp. subtilis 168: BSU01490
Entry
BSU01490          CDS       T00010                                 

Symbol
rplM
Name
(RefSeq) 50S ribosomal protein L13
  KO
K02871  large subunit ribosomal protein L13
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01490 (rplM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01490 (rplM)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01490 (rplM)
  Bacteria
    BSU01490 (rplM)
  Archaea
    BSU01490 (rplM)
SSDB
Motif
Pfam: Ribosomal_L13 EspB
Other DBs
NCBI-GeneID: 938915
NCBI-ProteinID: NP_388030
Pasteur: BG11970
BSORF: BG11970
UniProt: P70974 A0A6M4JCJ7
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
153842..154279
AA seq 145 aa
MRTTPMANASTIERKWLVVDAAGKTLGRLSSEVAAILRGKHKPTYTPHVDTGDHVIIINA
EKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLELAIKGMLPKGSLGRQMF
KKLNVYRGSEHPHEAQKPEVYELRG
NT seq 438 nt   +upstreamnt  +downstreamnt
atgcgtacaacacctatggctaacgcaagtactattgaacgcaagtggttagttgttgat
gctgctggcaagactttaggtcgtctttcttcagaagttgcagctatccttcgcggaaaa
cacaaaccaacttacacaccacacgttgatactggagatcatgtgatcatcatcaacgct
gaaaaaatcgagttaactggtaaaaagttaactgacaaaatctactaccgtcacactcaa
catccaggcggattaaaatcaagaactgctcttgaaatgcgtacaaactaccctgagaaa
atgcttgagcttgctatcaaaggcatgcttccaaaaggttctctaggtcgtcaaatgttc
aaaaaattgaacgtataccgtggttctgagcatccacacgaagcacaaaaacctgaagtt
tacgaacttcgcggttaa

DBGET integrated database retrieval system