KEGG   Bacillus subtilis subsp. subtilis 168: BSU01500
Entry
BSU01500          CDS       T00010                                 

Symbol
rpsI
Name
(RefSeq) 30S ribosomal protein S9
  KO
K02996  small subunit ribosomal protein S9
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01500 (rpsI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01500 (rpsI)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU01500 (rpsI)
  Bacteria
    BSU01500 (rpsI)
  Archaea
    BSU01500 (rpsI)
SSDB
Motif
Pfam: Ribosomal_S9
Other DBs
NCBI-GeneID: 938912
NCBI-ProteinID: NP_388031
Pasteur: BG19007
BSORF: BG19007
UniProt: P21470 A0A6M3Z6X6
Position
154300..154692
AA seq 130 aa
MAQVQYYGTGRRKSSVARVRLVPGEGRIVVNNREISEHIPSAALIEDIKQPLTLTETAGT
YDVLVNVHGGGLSGQAGAIRHGIARALLEADPEYRTTLKRAGLLTRDARMKERKKYGLKG
ARRAPQFSKR
NT seq 393 nt   +upstreamnt  +downstreamnt
ttggcacaggttcaatattacggtactggccgtcgtaaaagctctgtagcgcgtgtgcgt
ttagttccaggagaaggccgtatcgtcgttaataatcgtgaaatcagcgaacatatccca
tctgcagctttaatcgaagatatcaaacaaccattaactttgactgaaacagctggcact
tatgatgttttagtaaacgtacatggaggcggcctatctggtcaagctggagcaatccgt
cacggtatcgctcgtgctttgcttgaagcagatccagaataccgtacaactcttaaacgt
gcaggtcttctgactcgtgacgctcgtatgaaagaacgtaaaaaatacggtcttaaaggc
gctcgtcgtgcacctcagttctcaaaacgttaa

DBGET integrated database retrieval system