KEGG   Bacillus subtilis subsp. subtilis 168: BSU01830
Entry
BSU01830          CDS       T00010                                 
Symbol
ndhF
Name
(RefSeq) NADH-quinone oxidoreductase subunit 5
  KO
K05577  NAD(P)H-quinone oxidoreductase subunit 5 [EC:7.1.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU01830 (ndhF)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     BSU01830 (ndhF)
SSDB
Motif
Pfam: Proton_antipo_M Proton_antipo_N DUF3099
Other DBs
NCBI-GeneID: 938593
NCBI-ProteinID: NP_388064
Pasteur: BG10949
UniProt: P39755 A0A6M4JC87
Position
205409..206926
AA seq 505 aa
MLVSLSLSSLLTLFFIMLMASGISGLLFLHPRVPLSFVRIHIGILALPLLVSLLILANSG
VSGNVGPWHLDSLACLMTFFVLAIGFIIQRFSVRYLMGDRSYRKYFTLFTFTTGAASMTW
LSGDLRLMVLFWGATLVGLTLLIRLNSAWQVASEAAKISGRLFLLSWFSLFFAMMWLFHA
TGQWQLSLVVTNESLAGLGEWERTGIQLLIVLAVIIPAAQWPFQRWLVESIVAPTPVSAI
MHAGLVNAGGIILTRFSPLFHGGIASIILLLLASISVLIGTGISLVQVDYKRQLVGSTIG
QMGFMLIQCALGAYIAAIIHLILHGLFKATLFLQAGSAVGRHEVSTRTNERTSYLWVMAG
RILSLVIGVAFWLTAPGDGYHLISALILGWSLSVSWDQLVAFGEGRIGRIAGLTVLGGAA
LVYFIIHHLFYKWLHTTIFQSVQPPMSAVMIVVCLLLFGSALGTWVARHRSSVFFAVLYL
WLVRLGEAKPKSVESHPDYLKQYIS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgttagtttcgctgagtttgtcatcattattaacattattttttattatgcttatggct
tctgggattagtggactattgtttttacatccgcgtgtacccttgagttttgttcgcatt
catattgggatcttggctttaccacttttggtttccttactgattcttgccaatagtggt
gtgagtggaaatgttggcccttggcacttagattccttagcttgtttaatgactttcttt
gttcttgcaattggattcatcattcagcgtttttctgtacgttacttaatgggggatcga
tcttatcgaaaatattttacgctttttactttcacaacaggagctgcttcaatgacatgg
ttaagtggtgatctccgcttgatggttctattttggggagcaactcttgttggtttaacc
ttacttataaggttaaacagtgcttggcaagtggctagtgaagcagccaaaatttctgga
cggttatttttgttaagttggttttctttgttttttgcgatgatgtggctttttcatgcc
acaggtcaatggcagctatcattggttgtaacaaatgaaagtttagctgggctgggagaa
tgggagagaacagggattcagctattgattgtactggcggtgatcattcctgcagctcaa
tggccgttccaaagatggttggttgagtctattgttgctcccaccccagtttctgcaatt
atgcatgcaggtttagtaaatgctggaggaataatactaactcgattttcacctctattt
catggtggtatcgcttcgattatcttacttctgcttgctagcatttctgtattgattgga
actggaattagtttagttcaggttgattataaacgccagttagtaggctccacgattgga
caaatggggtttatgctcattcagtgtgcattaggcgcctatatagcagccattattcac
cttattttacatggtttattcaaggctacgttgtttctacaggctggttcagcagtaggg
cgtcatgaagtatcgactcgcactaatgaaagaacatcctatttatgggtcatggctggt
cggattttatccttagttataggtgttgctttttggctcactgctcctggagacgggtat
cacttaatcagtgcgctgatcttagggtggtcattgtccgtttcttgggatcagcttgtc
gcttttggagagggccgaattggccggattgccggtttaactgttttaggaggagcagcc
ctcgtatattttatcattcatcaccttttctataagtggctgcatacaaccatttttcaa
agtgttcaacctccaatgtcagctgtcatgattgtcgtatgtctcttactctttggcagt
gctttaggtacgtgggttgctcgtcatcgttcttccgtttttttcgcggtactctatctt
tggttagtccgattaggtgaagcaaaaccaaagtcagtagagagtcacccagactacctt
aaacaatatatttcataa

DBGET integrated database retrieval system