KEGG   Bacillus subtilis subsp. subtilis 168: BSU02630
Entry
BSU02630          CDS       T00010                                 

Gene name
tatAD
Definition
(RefSeq) Sec-independent protein translocase protein TatAd
  KO
K03116  sec-independent protein translocase protein TatA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03060  Protein export
bsu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU02630 (tatAD)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU02630 (tatAD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU02630 (tatAD)
Secretion system [BR:bsu02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   BSU02630 (tatAD)
SSDB
Motif
Pfam: TatA_B_E
Other DBs
NCBI-GeneID: 938398
NCBI-ProteinID: NP_388145
Pasteur: BG12777
BSORF: BG12777
UniProt: O31467 A0A6M3Z7N0
Structure
PDB: 
2L16

Position
285775..285987
AA seq 70 aa
MFSNIGIPGLILIFVIALIIFGPSKLPEIGRAAGRTLLEFKSATKSLVSGDEKEEKSAEL
TAVKQDKNAG
NT seq 213 nt   +upstreamnt  +downstreamnt
atgttttcaaacattggaataccgggcttgattctcatcttcgtcatcgccctcattatt
tttggcccttccaagctgccggaaatcgggcgtgccgccggacggacactgctggaattt
aaaagcgccacaaaatcacttgtgtctggtgatgaaaaagaagagaaatcagctgagctg
acagcggtaaagcaggacaaaaacgcgggctga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU05980
Entry
BSU05980          CDS       T00010                                 

Gene name
tatAY
Definition
(RefSeq) Sec-independent protein translocase protein TatAy
  KO
K03116  sec-independent protein translocase protein TatA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03060  Protein export
bsu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU05980 (tatAY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU05980 (tatAY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU05980 (tatAY)
Secretion system [BR:bsu02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   BSU05980 (tatAY)
SSDB
Motif
Pfam: TatA_B_E
Other DBs
NCBI-GeneID: 939878
NCBI-ProteinID: NP_388479
Pasteur: BG12206
BSORF: BG12206
UniProt: O05522 A0A6M3Z8F9
Position
647760..647933
AA seq 57 aa
MPIGPGSLAVIAIVALIIFGPKKLPELGKAAGDTLREFKNATKGLTSDEEEKKKEDQ
NT seq 174 nt   +upstreamnt  +downstreamnt
atgccgatcggtcctggaagccttgctgttatcgcaatcgttgctctgattatcttcggt
cccaaaaagctgcctgaattggggaaagcagcgggagacacacttcgtgaatttaaaaac
gctactaaaggattaacgagtgatgaagaggaaaaaaagaaagaagatcagtaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU17710
Entry
BSU17710          CDS       T00010                                 

Gene name
tatAC
Definition
(RefSeq) Sec-independent protein translocase protein TatAc
  KO
K03116  sec-independent protein translocase protein TatA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03060  Protein export
bsu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU17710 (tatAC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU17710 (tatAC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU17710 (tatAC)
Secretion system [BR:bsu02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   BSU17710 (tatAC)
SSDB
Motif
Pfam: TatA_B_E
Other DBs
NCBI-GeneID: 939527
NCBI-ProteinID: NP_389654
Pasteur: BG13464
BSORF: BG13464
UniProt: O31804 A0A6M4JH30
Position
complement(1905370..1905558)
AA seq 62 aa
MELSFTKILVILFVGFLVFGPDKLPALGRAAGKALSEFKQATSGLTQDIRKNDSENKEDK
QM
NT seq 189 nt   +upstreamnt  +downstreamnt
atggaattaagcttcacaaaaatactcgttattttgtttgtgggttttttagtatttggg
cctgataaactgccggcgcttggccgtgcagcaggaaaagccttatcagaatttaaacaa
gcaacaagcggactgactcaggatatcagaaaaaatgactcagaaaacaaagaagacaaa
caaatgtag

DBGET integrated database retrieval system