KEGG   Bacillus subtilis subsp. subtilis 168: BSU03330
Entry
BSU03330          CDS       T00010                                 

Symbol
nasA
Name
(RefSeq) nitrate transporter
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU03330 (nasA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03330 (nasA)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    BSU03330 (nasA)
SSDB
Motif
Pfam: MFS_1 LacY_symp
Other DBs
NCBI-GeneID: 938326
NCBI-ProteinID: NP_388215
Pasteur: BG11093
BSORF: BG11093
UniProt: P42432 A0A6M3ZAF0
Position
362937..364142
AA seq 401 aa
MKLSELKTSGHPLTLLCSFLYFDVSFMIWVMLGALGVYISQDFGLSPFEKGLVVAVPILS
GSVFRIILGILTDRIGPKKTAVIGMLVTMIPLLWGTFGGRSLTELYAIGILLGVAGASFA
VALPMASRWYPPHLQGLAMGIAGAGNSGTLFATLFGPRLAEQFGWHIVMGIALIPLLIVF
ILFVSMAKDSPAQPSPQPLKSYLHVFGQKETWFFCLLYSVTFGGFVGLSSFLSIFFVDQY
QLSKIHAGDFVTLCVAAGSFFRPVGGLISDRVGGTKVLSVLFVIVALCMAGVSSLPSLSM
VIVLLFVGMMGLGMGNGAVFQLVPQRFRKEIGMVTGIVGAAGGIGGFFLPNILGSLKQMT
GTYAIGFITFSCIALLAFALVLAAGYYWRKSWSAESSPADV
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaagctgtcggaactgaaaactagcggtcatccactcactttgctctgttccttttta
tactttgatgtcagttttatgatatgggttatgcttggggcgctgggtgtttatatttct
caggattttggcctgtctccttttgagaaagggcttgtcgtagctgtgccgattttatct
ggatctgtgtttcgtatcattcttggtattttaacggacagaatcggaccgaaaaaaacg
gcagtgatcgggatgctggtgacgatgattccgctgctttgggggacattcggcggccgt
tccctgactgagctgtatgccatcgggattctgcttggcgtggcgggagcaagctttgct
gtagcgctgcctatggccagccgctggtatccgcctcatttgcagggacttgcgatgggg
attgccggagcggggaacagcggcacgttgtttgcaaccctgtttggccctcgtctggca
gagcagttcggctggcacattgtcatgggaattgcgctaattccattattgatcgtcttt
attctttttgtatccatggcaaaggattcccctgcacagccgtctccccagccgctcaaa
agctatctgcatgtgtttgggcaaaaggaaacatggtttttctgcctgctgtacagcgtc
acatttggcggatttgtcgggctctcaagctttttatctattttctttgttgatcaatac
cagctgtcaaaaattcacgcaggggacttcgttacattatgtgtggcggcggggagcttt
ttccggcctgtcgggggcttgatttcagatcgtgtcggcggcacgaaagttctttctgta
ttgtttgtcatcgtggcactgtgtatggccggagtcagtagcctgccatctctctcaatg
gttattgttctattgtttgtcggaatgatggggctcggaatgggaaacggcgcagtattc
cagctcgtgccgcagcgcttccgcaaagaaatcggcatggtgacgggaatcgtcggtgcg
gccggaggaatcggagggtttttcttgccgaacatcttaggatctctcaaacagatgaca
ggcacatatgctatcggttttatcacgttttcctgtatcgcgctgctggcgtttgcactt
gtgcttgccgcaggctattactggcggaaaagctggagcgcggaaagcagcccggcggat
gtttag

KEGG   Bacillus subtilis subsp. subtilis 168: BSU37320
Entry
BSU37320          CDS       T00010                                 

Symbol
narK
Name
(RefSeq) nitrite extrusion protein
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU37320 (narK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU37320 (narK)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    BSU37320 (narK)
SSDB
Motif
Pfam: MFS_1 OATP 2-Hacid_dh_C DUF1686
Other DBs
NCBI-GeneID: 937055
NCBI-ProteinID: NP_391613
Pasteur: BG11342
BSORF: BG11342
UniProt: P46907 A0A6M3ZI50
Position
complement(3832327..3833514)
AA seq 395 aa
MINRQHIQLSLQSLSLVAGFMVWVLISSLISQITLDIHLSKGEISLVTAIPVILGSLLRI
PLGYLTNRFGARLMFMVSFILLLFPVFWISIADSLFDLIAGGFFLGIGGAVFSIGVTSLP
KYYPKEKHGVVNGIYGAGNIGTAVTTFAAPVIAQAVGWKSTVQMYLILLAVFALLHVLFG
DRHEKKVKVSVKTQIKAVYRNHVLWFLSLFYFITFGAFVAFTIYLPNFLVEHFGLNPADA
GLRTAGFIAVSTLLRPAGGFLADKMSPLRILMFVFAGLTLSGIILSFSPTIGLYTFGSLT
VAVCSGIGNGTVFKLVPFYFSKQAGIANGIVSAMGGLGGFFPPLILASVFQATGQYAIGF
MALSEVALASFVLVIWMYWQERMKTHTERNSQSIN
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgatcaaccgtcaacacattcaattatcgttacagtcattaagcttggtggcagggttt
atggtttgggtgctgatttcatcactcatttcccaaatcacattagatattcatttaagc
aagggtgagatttctttagtgaccgcgattcctgtgatcctcgggtcgcttctccgcatt
cctttagggtatttaacgaacaggtttggcgcgcggctcatgtttatggtcagcttcatc
ctgcttttatttcctgtattttggatcagtatcgcggattctctgtttgatttaatcgca
ggcggctttttcttagggatcgggggagcggtgttttccattggggtgacctccctcccg
aaatattatccgaaagaaaagcacggtgtcgtcaatgggatttacggtgcaggaaatatc
gggacagccgttacgacatttgcagcgccggttatcgctcaagccgtcgggtggaaatca
accgtgcaaatgtatctgattttgctggctgtctttgccttactgcacgtattgtttggc
gacaggcatgagaagaaggtcaaagtttctgttaagactcaaatcaaagctgtttaccga
aatcatgtgctatggtttctgagcctgttttattttattacgttcggtgcctttgtcgcc
ttcactatctatctgccgaactttctggtggagcattttgggctgaatcctgcagatgcc
ggcttgcggacggctggctttattgcggtttctacgctgctcaggcctgcgggcggattc
ctggctgataaaatgagcccgctccgcatcttgatgtttgtttttgccgggcttacatta
tcaggcattatcctatcgttctcgccgacaatcggcctttatacgtttggatcattaacc
gtggccgtctgctcaggcataggaaacggaactgtttttaaactggtgcctttctatttt
tcgaagcaagcggggattgccaatgggattgtgtctgccatgggcggtttaggcggcttt
tttcctccgctcatattggcgagtgtatttcaggcaacaggccagtacgcgatcgggttt
atggcgctttcagaggtggcgttagccagttttgtccttgtcatatggatgtattggcag
gaaagaatgaaaacacacacggagagaaacagccagagcatcaactaa

DBGET integrated database retrieval system