KEGG   Bacillus subtilis subsp. subtilis 168: BSU03380
Entry
BSU03380          CDS       T00010                                 

Symbol
yckB
Name
(RefSeq) ABC transporter substrate-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU03380 (yckB)
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU03380 (yckB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03380 (yckB)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU03380 (yckB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    BSU03380 (yckB)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Others
    BSU03380 (yckB)
SSDB
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1 DUF3692
Other DBs
NCBI-GeneID: 938320
NCBI-ProteinID: NP_388220
Pasteur: BG11178
BSORF: BG11178
UniProt: P42400 A0A6M4JCP7
Structure
PDB: 
2IEE

Position
complement(367995..368858)
AA seq 287 aa
MKSFMHSKAVIFSFTMAFFLILAACSGKNEADSKDTGWEQIKDKGKIVVATSGTLYPTSY
HDTDSGSDKLTGYEVEVVREAAKRLGLKVEFKEMGIDGMLTAVNSGQVDAAANDIDVTKD
REEKFAFSTPYKYSYGTAIVRKDDLSGIKTLKDLKGKKAAGAATTVYMEVARKYGAKEVI
YDNATNEQYLKDVANGRTDVILNDYYLQTLALAAFPDLNITIHPDIKYMPNKQALVMKKS
NAALQKKMNEALKEMSKDGSLTKLSKQFFNKADVSKKIDADVQDVDL
NT seq 864 nt   +upstreamnt  +downstreamnt
gtgaaatcattcatgcattccaaagccgttatattcagtttcacaatggctttctttctt
atattggcagcctgttccggcaaaaatgaagccgattccaaggatacaggctgggagcag
attaaggataaagggaaaatcgtagtcgctacatcaggtacgctctatcccacttcttat
cacgatactgactctggctctgataagctgacgggctacgaggttgaagttgttcgtgaa
gcggcaaaacgcttggggctgaaggttgagttcaaggagatgggcattgacgggatgctg
acagcggtgaacagcggacaggttgacgcagccgcgaatgacatcgatgtgacgaaggac
cgtgaggagaagttcgcattttccactccatataaatattcatacggcacggcaattgtc
cgaaaagacgatttatcagggattaaaacgctcaaggatttaaaagggaagaaagcggct
ggcgcggctacaaccgtctacatggaggtcgcgagaaaatacggcgccaaagaagtgatt
tatgataatgcgacgaatgagcaatatttaaaagatgttgccaacggacgcactgacgtc
attttaaacgactattacctgcagacacttgcgctcgcggcattcccggatctcaacatt
acaattcatcctgacatcaagtacatgccgaacaaacaggcccttgtcatgaaaaaaagc
aatgcggcacttcagaaaaagatgaacgaagcattgaaagagatgagcaaggatggctct
ttgactaaactgtcgaaacaattcttcaataaagcagatgtatcaaaaaaaattgatgcc
gacgttcaggacgttgatttgtaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU03610
Entry
BSU03610          CDS       T00010                                 

Symbol
tcyA
Name
(RefSeq) L-cystine-binding protein TcyA
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU03610 (tcyA)
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU03610 (tcyA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03610 (tcyA)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU03610 (tcyA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    BSU03610 (tcyA)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Others
    BSU03610 (tcyA)
SSDB
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd SBP_bac_5 DUF3947
Other DBs
NCBI-GeneID: 938298
NCBI-ProteinID: NP_388243
Pasteur: BG11187
BSORF: BG11187
UniProt: P42199 A0A6M3Z7F6
Position
complement(410656..411462)
AA seq 268 aa
MKKALLALFMVVSIAALAACGAGNDNQSKDNAKDGDLWASIKKKGVLTVGTEGTYEPFTY
HDKDTDKLTGYDVEVITEVAKRLGLKVDFKETQWDSMFAGLNSKRFDVVANQVGKTDRED
KYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNYNKLATNAGAKVEGVEGM
AQALQMIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGEPQSTYFTFRKGSGEVVDQ
VNKALKEMKEDGTLSKISKKWFGEDVSK
NT seq 807 nt   +upstreamnt  +downstreamnt
atgaaaaaagcattattggctttattcatggtcgtaagtattgcagctcttgcagcttgc
ggagcaggaaatgacaatcagtcaaaagataatgccaaagatggcgatctttgggcttca
attaagaaaaaaggtgtgctcacagtcggaacggaaggaacatatgagccgttcacttac
cacgacaaagacactgataaactgactggctatgatgtcgaagttatcacagaagtcgca
aaacgcctcgggcttaaagtcgactttaaggaaacacaatgggacagtatgtttgccggc
ctgaattccaaacggtttgacgttgttgccaaccaagtcggaaaaacagatcgtgaagac
aaatatgatttctcagataaatacacaacatcaagagccgttgtcgtaacgaaaaaagac
aacaacgatattaagtctgaagcagatgtaaaaggaaaaacgtcagctcaatcactgaca
agcaactacaacaaattagctacaaatgccggcgctaaagtagaaggcgttgaaggcatg
gcgcaggcccttcaaatgatccagcaaggccgcgtcgatatgacatacaacgataagctt
gccgtattgaactacttaaaaacatctggcaataaaaacgtgaaaatcgcgtttgaaaca
ggtgagcctcagtcaacatatttcacgttccgtaaaggaagcggcgaggttgttgatcaa
gtcaacaaagcattaaaagaaatgaaagaggacgggactctttctaaaatttctaaaaaa
tggttcggcgaagatgtttctaaataa

DBGET integrated database retrieval system