KEGG   Bacillus subtilis subsp. subtilis 168: BSU03410
Entry
BSU03410          CDS       T00010                                 

Symbol
bglC
Name
(RefSeq) aryl-phospho-beta-d-glucosidase BglC
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU03410 (bglC)
   00500 Starch and sucrose metabolism
    BSU03410 (bglC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BSU03410 (bglC)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 938317
NCBI-ProteinID: NP_388223
Pasteur: BG11181
BSORF: BG11181
UniProt: P42403 A0A6M3ZAF5
Position
370259..371692
AA seq 477 aa
MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIPGKTFKGTNGEIAVDH
YHRFKEDVALMAEMGLKAYRFSVSWPRVFPKGKGEINEAGLAFYDSLIDELLSHHIEPVL
TLYHWDLPQALMDEYGGFESRNIIEDFNHYCITLYKRFGDRVKYWVTLNEQNYNFNHGFI
TAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPEGKIGPSFAYSPAYPLSSHPEDI
LAFENAEEFTNNWWLDMYCWGTYPQIPFRCLEKQGWAPTIEAGDMDLLAKGKPDFVGVNY
YQTITYERNPLDGVSEGKMNTTGQKGTNQETGIPGVFKTKKNPHLTTSNWDWTIDPIGLR
IGLRRITSRYQLPVFITENGLGEFDKVEDGTVQDDYRIDYLRSHLEQCRQAISDGVDLIG
YCSWSFTDLLSWLNGYQKRYGFVYVNRDEESTSDLKRLKKKSFYWYQDVIKTNGESL
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgatccaccagcatccagaatcttttccgaaacattttttgtggggctctgcttctgca
gcgtaccagattgaaggcgcttggaatgaagatggcaaaggcccttctgtttgggatgtg
tttacgaaaataccgggcaaaacgtttaaaggaaccaatggcgagattgcggttgaccat
tatcaccgatttaaagaagatgtcgctctgatggctgagatggggttaaaagcatatcga
ttttccgtcagctggccacgggtttttccaaaaggaaaaggagagatcaatgaagcaggt
ctagcgttttacgatagtctgattgatgaattgctttctcatcacatcgagccggttctg
actttatatcactgggatttgcctcaagcgcttatggacgaatacggcgggtttgaatcc
agaaacatcatagaggattttaatcactactgtattactctttataaacgttttggagac
agggtgaaatattgggttacgttaaacgaacagaactacaattttaatcacggatttatt
acagccatgcatccgcctggagtgaaagacagaaaacgattttacgaagcaaaccatatt
gcgtttctggctaatgcaaaagccatcgaatcatttagagaatatgtgcctgaaggcaaa
ataggtcctagctttgcttattctccggcttaccctttatcaagtcatccagaggatata
ctggcatttgaaaacgccgaagaatttacgaacaattggtggcttgacatgtattgctgg
ggaacctacccgcaaattccattccgctgcttggaaaaacagggatgggcgccgacaatt
gaagcaggagatatggacctgctcgccaaagggaagcctgattttgtaggtgtcaattat
tatcagacgatcacctatgaacgaaatccgcttgatggtgtgtcagaagggaaaatgaat
acgacaggccaaaagggaaccaatcaggagacggggatacccggagtgttcaaaacgaaa
aaaaatccgcatctgacaacgagcaactgggattggacaattgacccaattgggctgcgt
atcggtcttcgccgaattacaagccgctatcagcttccagtgtttataacagagaacggt
ttgggtgaatttgataaagttgaggacggcactgtacaggatgattatcgaattgattat
ttgcgttcgcatcttgagcaatgcagacaagccatcagtgacggtgtcgatttaatcggc
tattgcagctggtcgtttactgatctgttaagctggctgaacggctaccaaaaaagatac
ggatttgtatatgtcaatcgtgatgaagaaagcacatccgatttaaaacgcttgaagaaa
aaaagcttttattggtatcaagatgtcatcaagacaaacggagaaagtttataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU05840
Entry
BSU05840          CDS       T00010                                 

Symbol
gmuD
Name
(RefSeq) 6-phospho-beta-glucosidase GmuD
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU05840 (gmuD)
   00500 Starch and sucrose metabolism
    BSU05840 (gmuD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BSU05840 (gmuD)
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-GeneID: 939872
NCBI-ProteinID: NP_388465
Pasteur: BG12193
BSORF: BG12193
UniProt: O05508 A0A6M3Z8A5
Position
628630..630027
AA seq 465 aa
MAHTEQYRFPKDFWWGSSASATQMEGAADRDGKGQNIWDYWFEKEPHRFFDHVGPADTSQ
FYDNYKEDIRLMKELGHNSFRMSISWSRLIPNGTGEINDKAADFYNNVIDELIANGIEPF
VNLFHFDMPMALQKIGGWVNRETVDAYENYARTCFRLFGGRVKKWFTHNEPIVPVEGGYL
YDFHYPNKVDFKEAVQVGFHTMLSSARAIQAYREMKQDGKIGIILNLTPSYPRSSHPADV
KAGEIADAFFNRSFLDPSVKGEFPKELVDILKHEGFMPDYNAEDLDIIKKNTVDLLGVNY
YQPRRVKAKEHLPNPDAPFLPDRYFDPYVMPGRKMNPHRGWEIYEKGVYDILINLKENYG
NIECFISENGMGVEGEERFRDEQGIIQDDYRIEFIKEHLKWIHRAIQEGSNVKGYHLWTF
MDNWSWTNAYKNRYGFVSVNLEKDGERTVKKSGKWFKEVAEHSGF
NT seq 1398 nt   +upstreamnt  +downstreamnt
ttggcacatacagaacaatatcgttttccaaaggatttttggtggggatcatccgcttca
gcaacacaaatggagggtgccgccgacagagacggaaaaggccagaatatatgggattat
tggtttgaaaaagaaccgcatcgtttttttgatcatgtcggacccgcagacacatcccaa
ttttacgacaactataaagaagatatcaggctgatgaaggaacttggccacaactcgttc
cggatgtcgatttcctggtcacgtttaataccaaacggaacgggcgagatcaacgataaa
gccgcagatttctataacaatgtcattgatgagctgatcgctaacggaattgaacctttt
gtcaatttgtttcatttcgatatgccgatggcgcttcaaaaaatcggcggctgggtcaac
agagagacggttgacgcgtatgaaaactatgcaagaacttgcttccgtttgtttggcggc
cgggtgaaaaaatggttcacgcataatgaaccaatcgttcccgtagaaggcggataccta
tatgattttcattatccaaacaaggtcgattttaaagaggccgtccaggttggatttcat
acgatgctatcaagtgcccgcgccattcaggcttacagggagatgaagcaggacggaaaa
atcggcatcatcttaaatttgaccccttcatacccgagaagcagccatccggcggatgtg
aaagccggggaaatcgcagacgcgttttttaacagatcttttttagacccatctgtcaaa
ggcgaatttcccaaagagctggttgacattttgaagcatgaaggctttatgcctgattac
aacgctgaagatctcgacatcatcaaaaagaacacggttgacctgttgggagtgaattat
taccagccgagacgtgtgaaagcgaaagaacatcttccgaatcccgacgctccttttttg
ccggacaggtattttgatccctacgtcatgccgggccgcaaaatgaatccgcatcgcggc
tgggagatctatgaaaaaggcgtttatgatattttgatcaatttaaaagaaaactacggc
aacatcgagtgttttatctctgaaaacggtatgggggttgaaggtgaagagcgattcagg
gatgaacaaggcatcattcaggatgattaccggattgaatttataaaagagcacctcaaa
tggattcaccgcgccatacaggaaggctcgaacgtaaaaggctatcacttatggacgttc
atggacaactggtcttggacaaatgcctataaaaaccgatacggatttgtatcagtcaat
cttgagaaagacggagaaagaaccgtcaaaaagagcggaaaatggttcaaagaggttgct
gagcatagcggtttctag

KEGG   Bacillus subtilis subsp. subtilis 168: BSU38560
Entry
BSU38560          CDS       T00010                                 

Symbol
licH
Name
(RefSeq) 6-phospho-beta-glucosidase
  KO
K01222  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU38560 (licH)
   00500 Starch and sucrose metabolism
    BSU38560 (licH)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BSU38560 (licH)
SSDB
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N
Other DBs
NCBI-GeneID: 937373
NCBI-ProteinID: NP_391735
Pasteur: BG11350
BSORF: BG11350
UniProt: P46320 A0A6M3ZK97
Position
complement(3958516..3959844)
AA seq 442 aa
MTKGLKIVTIGGGSSYTPELVEGFIKRYDELPVRELWLVDIPEGEEKLNIVGTLAKRMVE
KAGVPIDIHLTLDRRKALKDADFVTTQFRVGLLQARAKDERIPLKYGVIGQETNGPGGLF
KGLRTIPVILEIAKDIEELCPNAWLVNFTNPAGMVTEALLRYSNLKKVVGLCNVPIGIKM
GVAKALDVDVDRVEVQFAGLNHMVFGLDVFLDGVSVKEQVIEAMGDPKNAMTMKNISGAE
WEPDFLKALNVIPCGYHRYYFKTKEMLEHELEASQTEGTRAEVVQKVEKELFELYKDPNL
AIKPPQLEKRGGAYYSDAACNLISSIYNDKHDIQPVNTINNGAIASIPDDSAVEVNCVMT
KTGPKPIAVGDLPVSVRGLVQQIKSFERVAAEAAVTGDYQTALLAMTINPLVPSDTVAKQ
ILDEMLEAHKAYLPQFFNKIEA
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgacaaaaggattgaagattgtaacgattggcggaggttcaagctatacgcccgagcta
gtggaggggttcattaaacggtatgatgagctgcctgtccgtgaattatggcttgtcgat
atccccgagggcgaagaaaagctgaatattgtcggcacactcgccaaacggatggttgaa
aaagctggcgtcccgattgacattcatcttacgctcgaccggagaaaggcgctgaaagac
gcagactttgtcacgacccaattccgcgtcggacttttgcaggcaagagcaaaggatgag
cgcattccgctaaaatacggagtgataggccaggaaacaaacggcccgggaggtctgttt
aaaggattgcgcacaattccggtcatccttgagatcgcaaaggacatagaagagctttgc
ccgaacgcttggcttgttaacttcacaaaccctgccggcatggtaacagaagccttgctt
cgctactccaacctgaagaaagtcgtcggtctttgcaatgttccaatcggcatcaaaatg
ggcgtagccaaagcgcttgatgtagatgtggaccgcgtagaagtccaatttgccggactg
aaccatatggtattcgggctggatgttttcttggacggcgtaagtgtgaaggagcaagtc
atcgaggcgatgggcgacccgaaaaacgcgatgacgatgaaaaatatctcaggcgccgaa
tgggaaccggatttcttaaaagcgctcaatgtcatcccttgcggctatcaccgttactat
tttaaaacaaaagagatgctggagcacgaactggaagcatcacaaacggagggcacccgc
gctgaagtcgtacagaaggtcgaaaaagagctgttcgagctttataaagatccaaacctt
gcgatcaaaccgccgcagctggaaaaacggggcggagcttactacagtgatgcagcatgt
aacttaatcagctccatttataatgataaacatgacattcagccggtgaacacgatcaat
aatggtgcaatagcgagtattccagacgattccgcagttgaagtgaactgtgtgatgacg
aaaaccggccctaagccaattgctgtcggcgacttgccggtgtctgtccgcggccttgtc
cagcaaatcaaatcctttgaacgtgtcgcggcagaagcggcagttacaggtgactatcaa
actgcgctccttgccatgacgattaacccgcttgtcccgtccgatactgtggccaaacag
attttagacgaaatgctagaggcgcacaaagcgtatctgccgcagtttttcaacaaaatt
gaagcgtaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU39260
Entry
BSU39260          CDS       T00010                                 

Symbol
bglH
Name
(RefSeq) aryl-phospho-beta-d-glucosidase BglH
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU39260 (bglH)
   00500 Starch and sucrose metabolism
    BSU39260 (bglH)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BSU39260 (bglH)
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-GeneID: 937512
NCBI-ProteinID: NP_391805
Pasteur: BG10935
BSORF: BG10935
UniProt: P40740 A0A6M3ZHY9
Position
complement(4032346..4033755)
AA seq 469 aa
MSSNEKRFPEGFLWGGAVAANQVEGAYNEGGKGLSTADVSPNGIMSPFDESMTSLNLYHN
GIDFYHRYKEDIALFAEMGFKAFRTSIAWTRIFPNGDEEEPNEEGLRFYDDLFDELLKHH
IEPVVTISHYEMPLGLVKNYGGWKNRKVIEFYERYAKTVFKRYQHKVKYWMTFNEINVVL
HAPFTGGGLVFEEGENKLNAMYQAAHHQFVASALAVKAGHDIIPDSKIGCMIAATTTYPM
TSKPEDVFAAMENERKTLFFSDVQARGAYPGYMKRYLAENNIEIEMAEGDEELLKEHTVD
YIGFSYYMSMAASTDPEELAKSGGNLLGGVKNPYLKSSEWGWQIDPKGLRITLNTLYDRY
QKPLFIVENGLGAVDKVEEDGTIQDDYRINYLRDHLIEAREAIADGVELIGYTSWGPIDL
VSASTAEMKKRYGFIYVDRDNEGNGTFNRIKKKSFNWYQQVIATNGESL
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgagttcaaatgaaaaacgatttccagaaggatttttatggggcggcgcagttgctgcc
aaccaagtggagggtgcttataacgagggtggtaaggggctttcgacagctgacgtatcg
ccgaacgggatcatgtctccatttgatgaatcaatgacttccttgaatctgtatcacaac
gggattgacttttatcatcgttataaagaggatatcgccttatttgcagaaatgggattt
aaggcgttccgcacatcgattgcgtggacgagaatttttccgaatggcgatgaagaggag
cccaatgaagaaggcctcagattttatgatgatctgtttgatgagctgttaaagcatcat
attgagcctgtcgtaaccatctctcattatgagatgccgctcggtttagtgaaaaattat
ggcggctggaagaatcgcaaagtcatagagttttatgaacgctatgccaaaacggttttc
aaacgctatcaacacaaagtgaagtattggatgacgtttaatgaaattaacgtagtgctc
catgcgccatttaccggaggcggtcttgtttttgaagaaggagaaaacaaattaaacgcg
atgtaccaggcggcacaccaccaatttgtggccagtgctcttgctgtcaaagcgggtcac
gacatcattcctgattcgaaaatcggctgtatgatagcggcaacgacaacctatccgatg
acttctaagccggaggatgtcttcgcggcaatggagaatgagcgcaaaacacttttcttc
tcagatgttcaggcaagaggcgcatacccgggatatatgaaacgctatctggcagaaaac
aatattgaaattgaaatggctgaaggcgatgaagagctcttgaaagaacatacggtggat
tatattggatttagctactacatgtcgatggcggcgagcacagatccggaagagcttgca
aaatcagggggcaacctgctgggcggagtcaaaaacccttacctcaaatcatcagaatgg
ggctggcagattgatccgaaaggcttgcgcatcacgctcaacaccttatacgaccgttac
cagaagccgctgttcatcgttgaaaacggccttggcgctgtagacaaggttgaagaggac
ggcacgattcaggacgattacagaatcaactatctgcgtgatcatttaattgaagcgcgc
gaagccattgcggacggcgttgaattaatcggatacacatcatgggggccaattgacctt
gtcagcgcatctactgcggaaatgaaaaagcgctacggcttcatttatgtagaccgggac
aatgaaggaaatggaacatttaaccgcatcaagaaaaaaagcttcaactggtatcagcag
gttatcgccacaaacggagagagtctctga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU40110
Entry
BSU40110          CDS       T00010                                 

Symbol
bglA
Name
(RefSeq) aryl-phospho-beta-d-glucosidase BglA
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU40110 (bglA)
   00500 Starch and sucrose metabolism
    BSU40110 (bglA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BSU40110 (bglA)
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-GeneID: 937718
NCBI-ProteinID: NP_391891
Pasteur: BG11203
BSORF: BG11203
UniProt: P42973 A0A6M4JR50
Position
complement(4121166..4122605)
AA seq 479 aa
MGNMPKDFLWGGALAAHQFEGGWNQGGKGPSVVDVMTAGAHGVPRKITDTIEENEFYPNH
EAIDFYHRYKEDIALFAEMGLKCLRTSIGWSRIFPKGDEAEPNEAGLQFYDDVFDELLKH
GIEPVITLSHFEMPLHLAREYGGFRNRKVVDFFVNFAEACFTRYKDKVKYWMTFNEINNQ
MDVNNPLFLWTNSGVVVGENENAKEVMYQTAHHELVASALAVAKGKDINPEFQIGAMVSH
VPIYPFSSNPEDVMLAEEEMRQRYFFPDVQVRGYYPSYALKEFEREGYNITFEDGDDEIL
RNGTVDYLGFSYYMSTTVKSDVKNDNTGDIVNGGLPNGVENPYITSSDWGWAIDPTGLRY
TLNRFYDRYQIPLFIVENGFGAVDTLEEDGKVHDPERIQYLKSHIEALKKAVTYDGVDLI
GYTPWGIIDIVSFTTGEMKKRYGMIYVDRDNEGNGSMKRYKKDSFEWYKNVIQTNGEEL
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgggaaacatgccaaaggattttttatggggcggtgctttagctgcccaccaatttgaa
ggcggatggaatcaaggcggtaaagggccgagtgtcgtcgatgtgatgacagcgggtgcg
cacggcgtgccgagaaaaatcactgacacgattgaagaaaacgaattttatccaaaccat
gaagccattgatttctatcacagatacaaggaagatatcgctttgtttgcggaaatggga
ttaaaatgtctgcggacgtccatcggctggagccggatttttccgaaaggcgatgaggct
gaaccgaacgaagctggtttgcagttttatgatgatgtgtttgatgaattgctgaagcat
gggatcgagccggtcattaccctgtctcactttgaaatgccgctgcacctggcaagagaa
tatggcggcttcagaaaccggaaagtcgtggacttcttcgtcaacttcgcagaggcttgc
tttacccgttacaaagataaagtgaagtactggatgacatttaacgagattaacaaccaa
atggatgtgaacaatccgctgttcctatggacgaattcaggtgttgtggttggcgaaaac
gaaaacgccaaggaagtcatgtatcaaacggcgcaccatgaattagtggcgagcgcctta
gcagtggcaaaaggaaaagacatcaatccagagttccagattggggccatggtatcacac
gtgccgatttatcctttctcctccaatcctgaagatgtgatgctggctgaagaagaaatg
aggcagcgctatttcttccctgatgtgcaggttcgcggttattatccaagctacgcgttg
aaggaatttgaacgcgaaggctacaacatcacattcgaagacggcgatgatgagatttta
agaaacggaaccgtcgattacttaggcttcagctattacatgtcaacaactgtgaaaagc
gatgtgaaaaatgataacactggcgatattgtaaatggcggcttgccgaatggtgtcgaa
aatccgtacatcacttcgagtgactggggatgggcgattgatccaaccgggttgagatat
acgttaaatcgtttttatgaccgataccaaatcccgttattcatcgttgaaaatggcttt
ggcgcagtggatacgctggaggaggacggcaaggttcatgatccggaacgcattcaatat
ttaaaatcgcatattgaagcattgaaaaaagcggtcacgtacgatggtgttgatttaatt
ggctacacgccgtggggcattattgatattgtctccttcacaactggcgaaatgaaaaaa
cgctacggcatgatctatgttgatcgtgacaatgaaggaaacggatccatgaaacgatat
aagaaagactcctttgagtggtataaaaatgtcattcaaacgaatggtgaggaactataa

DBGET integrated database retrieval system