KEGG   Bacillus subtilis subsp. subtilis 168: BSU03440
Entry
BSU03440          CDS       T00010                                 

Gene name
tlpC
Definition
(RefSeq) methyl-accepting chemotaxis protein TlpC
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU03440 (tlpC)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU03440 (tlpC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU03440 (tlpC)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BSU03440 (tlpC)
SSDB
Motif
Pfam: MCPsignal sCache_3_3 Cache_3-Cache_2 sCache_3_2 HAMP BLOC1_2 DUF4042 DUF2206 Laminin_II ATG17_like EzrA Tetraspanin DUF1664 DUF4446 Mce4_CUP1 MAD NPV_P10
Other DBs
NCBI-GeneID: 938316
NCBI-ProteinID: NP_388226
Pasteur: BG10790
BSORF: BG10790
UniProt: P39209 A0A6M3Z7W5
Position
complement(372771..374492)
AA seq 573 aa
MLIKRFKMKLGTKILCLVFVVILLFSASVGTVMLKEITESMKQMATEKAKGDLALSSTYI
DDVMSGDWQVKNNKLYKGQTQINGNEDIVDLLGEKTGDTITIFQGDTRVATNVMKNGERA
VGTQASSEVIAAVLKKGKRFYGQADVAGSSYQTAYMPLKDQNGNIIGMLYTGANQSILAS
LTQSLFTQFAIVLVIVIMVSVILVLVFTRKINKRLNALKSAFESAGNGDMTIEVSDKTGD
ELSELSVYYNKMRMKLNDTIQTVQQSALQLASASQQLSAGAEETNQASEKITEAVQQIAN
GAQDQITRIENSESSLKQASADIRDISANTAAIADKGQLAQSKADIGQKEIANVQAQMDA
IHQSIQKSGEIIHQLDGRSKQIEQILSVITQIADQTNLLALNAAIEAARAGEQGKGFAVV
ADEVRKLAEESQQSAGQISKLIIEIQKDMNRSARSVEHVKTEAAEGVTMIQRTRDAFKEI
AAATGEISAEISDLSASVTNISASAHQINDSFAANTADIKESTKNTRQAAALTEEQFAAM
EEITAASETLSQLAEELTGIISQFKMINQAENG
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgttgataaaacgatttaagatgaagctaggaactaaaattctttgcctcgttttcgtg
gtgattcttttgttttcggcatcagttggcactgtgatgcttaaggaaattacagaaagc
atgaaacaaatggcaactgaaaaagcgaaaggtgatctcgctttaagcagcacttatatt
gatgatgtcatgtcaggcgactggcaggtgaaaaacaataagctctataaagggcaaaca
caaatcaatggaaatgaagatattgttgatctgcttggtgaaaagacaggtgataccatt
accattttccaaggcgatactcgtgttgcaaccaatgtcatgaaaaatggcgaaagagcc
gtcggcacccaggcttcttctgaagttattgccgctgttttaaagaaaggaaagcgtttt
tacggacaagcagatgtagcaggttcttcttatcagactgcatacatgccgttaaaagat
caaaatgggaacatcatcggcatgctgtataccggagctaatcaaagtattttagcatca
cttacacaatcacttttcactcaattcgctatcgttcttgttatcgtcattatggtatca
gtcatccttgtcttggttttcaccagaaaaatcaacaagcggctgaacgctttaaaaagc
gcctttgaaagtgccggaaacggagatatgacaatagaggtgtcagacaaaaccggtgac
gagctttcagaactaagcgtctattataataagatgagaatgaagctgaacgataccata
caaaccgtacaacaatcagcccttcagcttgcgtcagcctctcagcagctctcagccgga
gcagaggaaacaaatcaagcttcagaaaaaatcacagaagctgtacagcagattgcaaat
ggagcccaagatcagatcacccgaattgaaaatagtgaaagctcattaaaacaagcttca
gcagacatccgggatatttctgcaaatactgccgctatcgctgacaaagggcagctcgct
caatcaaaagcagacattggacaaaaggaaattgcaaatgtacaggcgcaaatggatgcg
attcaccagtcaattcagaaaagcggagaaatcatacaccagttagacggccgctctaaa
caaattgagcaaattttatcggtcatcacccaaattgctgatcagacaaacctgcttgcg
ctgaatgcagcgattgaagctgccagagccggtgaacaaggaaaaggctttgctgttgtt
gctgatgaagtacggaaattagcagaagagtctcaacagtctgcggggcagatttcaaaa
ctgatcatagaaatacaaaaggatatgaaccggtctgcaagatctgttgagcatgtgaaa
acagaagctgcagaaggagtcaccatgatccagcgcaccagagatgcatttaaggaaatt
gcagctgcaacaggtgaaatcagcgccgagattagtgatttatcagcatctgtaacaaac
atttcagccagtgcacatcaaataaatgattcctttgcagccaatacggccgacattaaa
gaatctactaaaaatacccggcaagcggctgcattaacagaggagcaatttgctgcaatg
gaggagattaccgcagcttctgaaacactttctcaattagctgaggagcttaccggtatc
ataagccaatttaaaatgattaatcaagccgaaaacggctga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU13950
Entry
BSU13950          CDS       T00010                                 

Gene name
mcpC
Definition
(RefSeq) methyl-accepting chemotaxis protein McpC
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU13950 (mcpC)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU13950 (mcpC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU13950 (mcpC)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BSU13950 (mcpC)
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP sCache_2 UPF0242 DUF948 DUF4229
Other DBs
NCBI-GeneID: 936206
NCBI-ProteinID: NP_389278
Pasteur: BG11533
BSORF: BG11533
UniProt: P54576 A0A6M4JHN7
Position
1463628..1465595
AA seq 655 aa
MFKKLHMKIAVFVSIMLIITVVLLMLSSYLTLKPMITEDGKNTTQNVTQSLEQNIELQLK
SYAISLSRLANGELTHTFVTKPSKEASRLFHDDIKQIKDNDDYVAMAYIGTAKKEMFTYP
KADFAEDYDPTSRPWYKLAAETPDQVVWTEPYKDVVTGDMIVTASKAILDRQKVIGVASY
DLKLSAIQSMVNKQKVPYKGFAFLADASGNLLAHPSNQGKNISKDQTLQTIASEKKGIQD
VNGKMVVYQTIGETGWKVGTQFDTDQLMWISDKMNRANLWISLIALIITIILSYFLAKTI
TGPIQQLIVKTKAVSAGDLTVRAESKSKDEVGILTRDFNLMVENMKEMVEQVRLSSGKVS
DTSEQLTAVAAETNETSGQIAKAIEEVAAGASEQASEVETINEKSESLSTKIRQIAEEAG
GIKERSKSSEDASYKGLDALGQLLMKSNEANMETKKVETMLLDLENQTKNIEEVVTAISN
ISDQTNLLALNASIEAARAGESGRGFAVVADEVRKLAEQSALSTKHISETVKLIQLETKE
ASHAMVEASRMNDEQNSAIHETGEVLNTITAEMQSLVQGIDHIYAEIQRMSEEQLAISEA
IQSISAISQESAAAAEEVNASTDEQLVTLDKVKHSTETLKHASQELMNTIAKFTL
NT seq 1968 nt   +upstreamnt  +downstreamnt
ttgtttaaaaaacttcacatgaagattgctgtttttgtttcgattatgttaatcatcaca
gttgttctcttaatgctgtcttcttatttgacgctaaaaccgatgattacagaggatggg
aaaaatacaactcaaaacgtgacgcagtcacttgaacaaaatattgaattgcaattaaag
agttatgccatttcgttatcaagattggctaatggggaattaacgcatacatttgtaacg
aaaccaagtaaagaagcttctcggctgtttcacgatgacattaagcaaatcaaagacaac
gatgattatgttgcgatggcttacataggcaccgcaaaaaaagaaatgtttacatatcca
aaagcggatttcgctgaggattacgatccaacatcaagaccatggtataagcttgcagct
gaaaccccggatcaagttgtttggacggaaccttataaagatgtcgtgacaggagacatg
attgttactgcatcgaaagcgatcttagacaggcaaaaagtgataggggttgccagctat
gacttgaaactctctgctatccagagtatggtcaataaacaaaaggtgccttacaaagga
tttgcctttttagctgatgcgagcggcaatcttttagcccatccgtcaaatcaaggaaaa
aatatatcaaaggatcaaacactgcaaaccatcgcatccgagaaaaaagggatacaagat
gtgaatgggaaaatggttgtgtaccaaacgattggcgagacaggctggaaggtcggaacg
caatttgataccgatcaattaatgtggatttcagataaaatgaatcgggccaatctttgg
atatcattgattgcgcttatcataacaattattctcagctacttcctggccaaaacgata
accggtccgatacagcagctgatcgtaaaaacgaaagctgtttccgcaggcgatttaaca
gtgcgcgcggaatcaaaatctaaggatgaagtcggtattttaacaagagatttcaatctg
atggttgaaaatatgaaggaaatggttgagcaagtgagactctcttcagggaaagtatct
gacacctctgaacaactaacggctgtggctgccgaaactaatgaaacaagcggacaaatt
gcaaaagcgattgaagaagtagccgcaggggcatcggaacaggcttctgaagttgaaacc
attaatgaaaaatcggaaagcctgtcaacgaaaatcaggcaaatcgctgaggaggcaggc
ggaattaaagaacgctcaaaatcgtccgaggatgcaagctataaaggacttgacgcgctc
ggccagctgctgatgaaatcaaacgaagccaatatggaaacgaaaaaggttgaaacgatg
ctgctggatttggaaaatcaaactaagaatattgaagaagtcgttacagcgatttcaaac
atatctgatcaaaccaacttgcttgccttaaatgccagtattgaggcagccagagccgga
gaaagcgggcgcggttttgccgtcgtagccgatgaagtgcggaagttagctgagcaatca
gccctttctacaaagcatatcagcgagactgtgaagcttatccagcttgagacaaaagag
gcctctcacgcgatggttgaggcaagcagaatgaatgatgaacaaaacagtgcaattcac
gaaactggagaggtattaaatacgataactgcagaaatgcagtcactggtacaaggtatt
gatcacatttacgcggaaattcaaagaatgagtgaagaacagcttgcgatttctgaagcc
attcaaagcatttcagccatatcacaggaatcagctgccgcagcagaggaagtgaacgca
tcaaccgatgaacagcttgtcacccttgataaagtcaaacactcaacggaaacactaaaa
catgcaagccaagagcttatgaacacaattgcaaaattcacattgtaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU31230
Entry
BSU31230          CDS       T00010                                 

Gene name
tlpB
Definition
(RefSeq) methyl-accepting chemotaxis protein TlpB
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31230 (tlpB)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU31230 (tlpB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU31230 (tlpB)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BSU31230 (tlpB)
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP MnmE_helical HAMP_2 BLOC1_2 dCache_2 DASH_Dad2 AI-2E_transport Syntaxin DUF1732 GlcNAc-1_reg TMP_3 COG2 DUF1664
Other DBs
NCBI-GeneID: 937152
NCBI-ProteinID: NP_391001
Pasteur: BG10862
BSORF: BG10862
UniProt: P39217 A0A6M4JLK3
Position
complement(3204067..3206055)
AA seq 662 aa
MGKFIQWIKQPSISKPLIAAFLAVLILPVGVLAYFSYQSAWNALDRELISSAKGNVEELN
STLQNKLEDKVKAIDYYSETVDKDILLGKNKTLLKEKFKQYTTLNDDVGAIYAASEDKKL
YKYPDSGVPKGFDPTGRDWYKQAVAEKGQAVFSEPYTDEATGDIVVTISKQLKDGSGVIA
LDLNLDEVLTASKRIKIGKEGFAFITTGNKKYIAHPTIKPGTTGSGDWTNQVYSKKEGSF
EYTFEGKEKKMAFTTNKLTGWKIAGTYFVSELQDASSPVLNTAVIILCVSIVIGGILILY
IIRAITKPLRKLVSTSAKISSGDLTEVIDIHSKNEFGQLGESFNEMSASLRSVIGVIQTS
VENVASSSEELTASAAQTSKATEHITLAIEQFSDGNEAQSEKLETSSNHLSQMNEGISKV
AQASSTITKSSIQSSEAAGSGEKLVEHTVGQMKTIDQSVQKAEAVVKGLETKSQDITSIL
NVINGIADQTNLLALNAAIEAARAGEYGRGFSVVAEEVRKLAVQSADSAKEIEGLIQEIV
REISTSLSMFQSVNHEVKEGLQITDQTAESFKQIYEMTTQISGELQNLNATVEQLSAGSQ
EVSSAVEDISAVAKESSAGIQDIAASAEEQLASMEEISSSAETLANMAEELQDITKKFKI
ES
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgggaaaattcatacaatggatcaaacagccatcgatcagcaaaccgctaatcgctgcg
tttctggcagtgcttattttgccggttggggttttagcatatttcagttatcaatcagct
tggaacgcgttagacagagagctcataagcagtgcgaagggaaatgttgaagaactaaac
agtacgctgcaaaataaattagaagataaagtaaaagcaatagattattatagtgagaca
gtcgataaagacatattgttaggcaaaaacaaaacattactgaaagagaaatttaagcag
tacacgacacttaacgacgatgtaggcgcaatctatgctgcctcagaagataagaagctt
tataaatatccggatagcggtgttccgaaaggtttcgatccgacaggacgtgactggtac
aaacaggcggttgcggaaaaaggacaagctgttttctcagaaccgtataccgatgaagcg
acaggagatatcgttgtcacaatttcaaaacaattaaaagacggttcaggggttatagcg
ctagatttaaacctggatgaagtgcttactgcatcaaaaagaatcaaaatcggaaaagaa
ggctttgcatttattacgacaggcaacaaaaaatatatcgcccatccgaccattaagccg
gggacaaccggttccggcgattggacaaaccaagtatattccaaaaaagaaggctcattt
gaatatacattcgaaggcaaagaaaagaaaatggcctttacgacaaataaactgactggc
tggaaaatcgcgggcacatattttgtcagtgaattgcaagatgcttcaagcccggtgctg
aacactgcggttatcattctatgcgtgtcaatagtaatcggcggcatactcatactctat
attatccgtgccatcaccaagccgttaagaaaacttgtctcaacgtctgcaaaaatcagc
agcggagatctcacagaagtcattgacattcactcgaaaaacgagtttggccagcttggc
gaaagctttaatgaaatgtctgcatcattgcgttctgtaataggcgttattcaaacgtct
gtagaaaacgtcgcttcatcttctgaggagctgacagcaagcgcagcccaaacaagcaag
gcaactgaacatattacacttgccatcgaacagttctcagatggcaacgaggcacaaagc
gagaaactggaaacaagctcaaatcatctttctcaaatgaacgaggggatttcaaaagtg
gctcaagcctcttcaaccattacgaaatcatcgattcagtcctctgaggcagcgggcagc
ggagaaaagctggtggagcatacagtcggccagatgaaaacaattgaccaatccgttcaa
aaagcggaagcggttgtgaagggccttgaaacaaaatcgcaagacatcacaagcatcttg
aatgtgattaacggcattgctgatcaaaccaacctgcttgcattaaatgctgcgattgag
gcggcaagagcgggagaatacggaagaggtttctcagtagttgcggaagaggttagaaaa
cttgctgtacaatcagcagactccgccaaggaaattgaaggattaattcaagagattgtc
agggaaatcagcacctcactttcaatgttccaatccgtgaatcatgaagtgaaagaaggc
ttgcagattacggatcaaacagcggaaagctttaaacaaatctatgagatgacaacccaa
atttccggcgaattgcaaaacttgaacgcgacggttgaacaactgtcagccggatcacag
gaagtgtcaagtgctgttgaagatatttctgcagtggcgaaagaaagctcagcaggcatt
caggatatcgcagcttcggcggaagaacagcttgcgtccatggaagaaatcagctcttca
gcggaaacgttggcaaacatggcggaagaacttcaggacattacgaagaaatttaaaata
gaatcataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU31240
Entry
BSU31240          CDS       T00010                                 

Gene name
mcpA
Definition
(RefSeq) methyl-accepting chemotaxis protein McpA
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31240 (mcpA)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU31240 (mcpA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU31240 (mcpA)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BSU31240 (mcpA)
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP Cache_3-Cache_2 dCache_2 I_LWEQ HAMP_2 ATG17_like Phage_DsbA DUF1664 DUF2228 DUF16 Folliculin Virul_fac_BrkB DUF5798
Other DBs
NCBI-GeneID: 937154
NCBI-ProteinID: NP_391002
Pasteur: BG10861
BSORF: BG10861
UniProt: P39214 A0A6M3ZJ53
Position
complement(3206169..3208154)
AA seq 661 aa
MKKILQLIKQRSITRKLLVSFLSILIIPVVILAIFAYQSASSSLDRQMMGSALENVQQLN
EIINTSIGEKENSADYFSEWLTKEKYNAKSNASIAEKFSQYISINKDVESIYTSDTKGHF
TRYPDLPMPSGYNPVERDWYKKAVANKGKVVITDPYKTASTNTMVVTIAQQTKDGSGVIA
INMTIENLLKTTKKVNIGTQGYAFIMTKDKKVVAHPNEQSGTELKGDWLDKMLSADKGDF
QYTMDGDKKKMAFDTNKLTGWKIGGTMYLDEIHEAAQPVLHLALIVLAAAIIIGIIVMTL
IIRSITTPLKQLVGSSKRISEGDLTETIDIRSKDELGELGKSFNNMASSLRSLIHAIQDS
VDNVAASSEELTASAAQTSKATEHITLAIEQFSNGNEKQNENIETAAEHIYQMNDGLTNM
AQASEVITDSSVQSTEIASEGGKLVHQTVGQMNVIDKSVKEAEQVVRGLETKSKDITNIL
RVINGIADQTNLLALNAAIEAARAGEYGRGFSVVAEEVRKLAVQSADSAKEIEGLIIEIV
KEINTSLGMFQSVNQEVQTGLDITDKTEMSFKRISEMTNQIAGELQNMSATVQQLSASSE
EVSGASEHIASISKESSAHIQDIAASAEEQLASMEEISSSAETLSSMAEELRDMTKRFKI
E
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaaaaaaatactccaactcataaaacaaagatcaattacacggaagcttctcgtttcc
tttctgtcgatcctcatcataccggttgtcatattggcgatctttgcgtatcaatcggct
agcagctcactcgacagacagatgatggggagcgcattggaaaatgtacagcaattaaac
gaaatcattaacaccagcatcggcgaaaaagaaaacagtgctgattatttcagcgaatgg
ctgacaaaagagaaatacaatgcaaaaagcaatgcaagcattgcagagaaattctcacaa
tatatcagcattaacaaggatgtagaatccatttatacaagtgacacaaaagggcacttt
acccgctatccggatcttccgatgccaagcggctataatccggttgaacgcgactggtac
aaaaaagcggttgcaaataaagggaaagtcgtgatcacagacccttataaaaccgcgtcg
acaaatacgatggttgtgacaatcgcccagcagacaaaagatggttcaggcgttatcgca
atcaacatgacgattgaaaatctgctgaaaacaaccaaaaaagtcaacatcggcacacaa
ggctacgcatttatcatgacgaaggacaaaaaagttgtcgcacaccctaatgaacaatca
ggaactgaattaaaaggcgactggctcgataagatgttgagtgctgataaaggcgatttt
caatacaccatggatggcgataagaaaaaaatggcctttgacacaaacaagttgacggga
tggaagatcggcggcaccatgtatttggatgaaatccatgaggcagcccagcctgtcctt
caccttgctttaattgtcttggccgcagctattatcatagggattatcgtcatgacattg
atcattcggtcgattacaacaccgctgaaacagcttgtcggttcctctaagcggatcagc
gagggagatttgacggaaaccattgatatccgttcaaaagatgaattgggcgagctcggc
aaaagctttaacaatatggcgtcgtcacttcgttctctcatacacgccatccaggattcg
gtagacaatgttgccgcttcctctgaggagctgactgcatcagctgcgcaaacgagcaag
gcaacagagcacattacattggcgattgaacaattttctaacggcaatgaaaaacaaaac
gaaaacattgaaacggcagcagagcacatttatcaaatgaatgacgggttgacgaatatg
gctcaagcttctgaagtgatcactgattcatctgttcaatcgacagaaattgcaagtgaa
ggcggcaagcttgttcatcaaaccgtcggccaaatgaatgtcattgacaagtccgttaaa
gaagcggagcaagtcgtacgcggattggaaacgaaatcgaaagatattacaaacattttg
cgtgtgatcaacggcatcgcagaccagacgaacctgcttgccttaaacgcagcaattgaa
gcagcgcgcgcaggcgagtacggccgcggcttctccgttgtagcggaagaagtaagaaaa
ctggcagtacagtcagcagattcagcaaaagagattgaaggattaatcatcgaaattgtg
aaggaaatcaatacatcactcggcatgttccaatctgtcaatcaagaggtgcagacagga
cttgacatcacagataaaacagaaatgagcttcaaacgcatttctgaaatgacgaaccaa
atcgccggcgaactgcaaaatatgagtgcgacggttcagcagctttctgccagctccgaa
gaagtttcgggagcgtctgagcacattgcatcgatttcaaaagaaagctcagcgcatata
caagatatcgcggcgtcagctgaagagcagctagcttccatggaagaaatcagctcgtct
gcagagaccctttcctctatggcggaagagcttcgggatatgaccaaacgatttaaaatt
gaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU31250
Entry
BSU31250          CDS       T00010                                 

Gene name
tlpA
Definition
(RefSeq) methyl-accepting chemotaxis protein TlpA
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31250 (tlpA)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU31250 (tlpA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU31250 (tlpA)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BSU31250 (tlpA)
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP Cache_3-Cache_2 HAMP_2 dCache_2 DUF948 Syntaxin_2 Laminin_I Phage_DsbA HEF_HK TMP_3 ISG65-75 DUF1664
Other DBs
NCBI-GeneID: 938840
NCBI-ProteinID: NP_391003
Pasteur: BG10860
BSORF: BG10860
UniProt: P39216 A0A6M4JMY2
Position
complement(3208280..3210268)
AA seq 662 aa
MKKTLTTIRRSSIARRLIISFLLILIVPITALSVSAYQSAVASLDVQMTQSAKENVQILD
HIIDDKISTTEKSLAYFSDWATAEKFQDKKKTELKQEFKQFIQMNDNVAAVFSSGKDGDF
TRYPYADMPSDFNALERDWYKEAMANKGKTIVTEPYESISSGKMVVTIARQTVDGSGVVA
IDMKIDDLVTTAKGINIGKEGYAFILSQNKKVIAYSGEKAGTELKGDWVDKLYKDKSGDF
EYTYKGKKKKMAFATSQTTGWKISGTMYANEIHDAASRVLIMASIVLAIAIGAGMTAIYF
VIRSITKPLRRIVASAEKISEGDLTETIEINSKDELGVLSESFNHMAHSLRSLIHGIKDS
VEHVASSSEELTASADQTSRATEHITMAIEQFSNGSESQSEKIETTTEQINEMNDGLAEL
ARAAAVITETSADSTEVSSKGETLVQKTAGQMNTIDHSVKAAEQVVKGLEIKSKDITNIL
RVINGIADQTNLLALNAAIEAARAGEYGRGFSVVAEEVRKLAVQSADSAKEIESLISEIV
KEIHTSLNVLQSVNKEVETGLVMTDETKQSFKHISQMTNQIASELQNMNATVEELSAGAQ
EISAASNDITAISKESSDGIQDIAASAEEQLASMEEISSSALTLERMSEELRDLTKQFKV
DK
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgaaaaaaacactcaccactattcgcagatcatcaattgcaaggagacttattatttct
ttcctgctgatcttaattgttccgataaccgccctttcggttagcgcttatcaatcagca
gttgcctcacttgatgtacagatgacgcaaagcgcaaaggaaaatgttcagatattagat
cacatcattgatgataaaatcagcactactgaaaaaagcctcgcatatttcagcgattgg
gctacagcagaaaaatttcaggataaaaagaaaacagagctgaaacaggaatttaaacaa
tttatccaaatgaatgataatgtcgctgcggtattttcaagcggcaaagacggggacttc
acacgttatccgtacgctgacatgccaagcgactttaatgctttggaacgagattggtac
aaagaagcaatggccaataaaggcaaaacaattgtcactgagccttatgaatcgatttca
tcaggaaaaatggtcgtcaccatcgcccgtcaaacggtggatgggtcaggcgttgtcgcc
attgatatgaaaattgatgacttagtcactaccgcgaaaggaatcaatatcggaaaagaa
ggctatgcttttattttgagccaaaacaagaaagtcatcgcctactccggagaaaaagcg
ggaacagagctaaaaggggactgggttgataagctctacaaggataaaagcggggacttt
gaatatacgtacaaaggcaaaaagaaaaaaatggcatttgcaacaagccaaacaacaggc
tggaaaatcagcggcacgatgtatgcaaacgagattcacgatgctgcaagcagggttctg
atcatggcttcaatcgttctggcgattgccatcggagctggaatgacggcgatttatttt
gtgattcgatccatcacaaagccattgagacgcattgtcgcatccgctgaaaaaattagt
gaaggcgatctaaccgaaacgattgaaatcaattcaaaagatgaactcggcgttctgagt
gagagcttcaatcatatggcacactcgcttcgctcgctcattcacgggatcaaagactca
gtagaacacgttgcctcctcgtctgaagagctgactgcatcggcagaccagacaagcaga
gccactgagcacattacgatggctatcgagcaattttcaaacggcagtgaaagccaaagc
gagaaaatagaaacgacaaccgaacaaattaatgaaatgaatgacggattggcagagctg
gcgcgggctgcagcagtgattacagaaacatccgcagattcaaccgaagtgtcaagcaaa
ggggagacactcgtccagaaaacagccggccaaatgaacacaattgaccattccgtaaaa
gcagcggaacaagtggtgaaagggctggagatcaaatcaaaggatatcacgaatattttg
cgtgtcatcaacggcattgcggatcaaaccaatcttttggctttaaatgccgccattgaa
gctgccagagcgggtgaatacggccggggcttctcagtcgtcgctgaggaagtgagaaag
ctcgcggtacagtcggctgactcagcaaaagaaattgaatcgctgatcagtgaaatagta
aaagaaattcacacatcactgaacgtgcttcagtccgtaaacaaagaagttgaaacaggg
cttgtcatgacggatgaaactaaacagagcttcaaacatatatcgcaaatgaccaatcaa
attgcttccgagctgcaaaacatgaatgcgacggttgaggagctgtcagcgggagctcaa
gaaatttccgcagcttcaaatgatatcactgccatttctaaggaaagctcggatggcatc
caagatatcgccgcttcagctgaggaacagctggcatccatggaggagattagttcatct
gcactgacgcttgaaagaatgtctgaagaactccgtgatctgacaaaacaatttaaagta
gacaaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU31260
Entry
BSU31260          CDS       T00010                                 

Gene name
mcpB
Definition
(RefSeq) methyl-accepting chemotaxis protein McpB
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31260 (mcpB)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU31260 (mcpB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU31260 (mcpB)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BSU31260 (mcpB)
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP Cache_3-Cache_2 dCache_2 HAMP_2 DUF1664 Laminin_II Med9 BAR_3_WASP_bdg ATG17_like DUF5798 LXG TMP_3
Other DBs
NCBI-GeneID: 937155
NCBI-ProteinID: NP_391004
Pasteur: BG10859
BSORF: BG10859
UniProt: P39215 A0A6M4JMS8
Position
complement(3210445..3212433)
AA seq 662 aa
MKTFINWLKKPSISKKLIVSFIAILIIPILILEFSSYRSASGKLDQEIMGNAKNSVDTFN
TTVTNDLGEKAKAVTFFSESLKRSAFKGKSNQEEIKAKFSQYVSINQGVARIYGGADNGT
YVQAPKEKLPEGYDPRQRPWYQDAMKAGGEIVVTDPYVAASDGSMVITIAQELKDGSGVV
AMDITIDKLLEQMKQIKVGKEGYAFIATKNKTYVAHKNHKAGEKLSGDWVAKMYANDSGE
LQYTLNNEDKKMTYTTNELTGWKIAGTMYMDEIKDASKSVLTTGMIVLIASIVAGGILIL
FIVRSITKPLKRLVQSSKTISRGDLTETIEIHSKDELGELGESFNEMGQSLRSLISAIQD
SVNNVAASSEQLTASAGQTSKATEHITMAIEQFSNGNEEQSEKVESSSHQLNLMNEGLQQ
VSQTSSDITKASIQSTEIAGTGEKFVQQTVGQMNSINQSVQQAEAVVKGLEGKSKDITSI
LRVINGIADQTNLLALNAAIEAARAGESGRGFSVVAEEVRKLAVQSADSAKEIEKLIQEI
VAEIDTSLHMFKEVNQEVQSGLVVTDNTKESFQSIFSMTNEIAGKLQTMNSTVEQLSDRS
QHVSAAVSGIADVSKESSASIQDIAASAEEQLASMEEISSSATTLAQMAEELRDLTKQFK
IE
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgaagacttttatcaattggctgaagaaaccgtctatttcaaagaaattaatcgtctca
tttattgcgattctcattatccctattcttatattagaatttagctcttaccgaagcgcc
agcggaaagctggatcaggaaattatgggaaatgcgaaaaacagtgtcgatacatttaat
acaactgttacaaatgatctgggagaaaaagcgaaagcagtcacctttttcagtgaatct
cttaaaagatccgcattcaaagggaaatcaaatcaagaagagatcaaagctaaattttca
caatatgtatctattaatcaaggagtagccagaatttatgggggcgcagataacggcact
tatgtacaagcgccaaaagaaaaattgccggaaggatacgacccgagacaacggccttgg
taccaggatgcgatgaaggccggcggtgaaattgtcgtgacagatccttacgtggctgcg
agtgacggaagcatggtcattaccattgcacaggagctgaaggacggatctggcgttgtc
gccatggatattaccattgataaattgttagaacaaatgaaacaaatcaaggtcggaaaa
gaaggttatgctttcattgcaacaaaaaacaaaacctatgtcgcccacaagaaccataag
gctggagaaaagctttcaggcgactgggtagccaaaatgtatgcgaatgacagcggtgaa
ctccagtatactcttaataacgaagataaaaagatgacctatactacaaacgaactgact
ggttggaaaatagccggcacaatgtatatggatgaaattaaggatgcctcaaagtctgtg
ctgacaacaggaatgattgtgctgattgcttccattgtggcaggcggaattttaattctg
tttatcgttcgttcgattacaaaaccgttaaaacgtcttgttcaatcatcgaaaacgatc
agcaggggggatctgaccgaaacgatcgaaatccattcaaaggatgagcttggagagctt
ggggaaagcttcaatgaaatgggacaatctctccgctctctgatcagcgctattcaggac
tcggtgaacaatgtggccgcatcttccgaacagcttaccgcatctgccgggcagacgagt
aaagccaccgagcatattacgatggcgattgagcagttctcaaacggaaacgaggagcaa
agcgaaaaggttgaatccagctctcatcagctgaacttaatgaatgaaggactccagcaa
gtctcacaaacatcgtcagatattacaaaggcatctatccaatcaacggaaatcgccgga
acgggtgagaagtttgtgcagcagacagtcggacaaatgaactcgattaatcaatctgtt
cagcaggctgaagctgttgtcaaaggcttagaaggaaaatcaaaagacatcacaagcatt
ttgagagtcatcaacggaatcgctgaccaaacaaatctgcttgcactaaatgcagccatt
gaagcggcgcgtgccggagagtcaggacgcggcttctctgtcgtagcggaggaggtgcgc
aagctggctgtccaatcagccgattcagcgaaagaaatcgaaaagctgatccaagaaatc
gtcgcagaaatcgacacctctcttcacatgtttaaagaggtcaatcaggaagtacagtcc
ggacttgttgtcacagacaatacaaaagaaagcttccagagcattttcagcatgacaaac
gaaatcgcgggcaagctgcagacgatgaattccaccgtcgagcagctgtcagaccgttca
cagcatgtttcagcagcagtcagcggcattgcagacgtgtcgaaagaaagctcggcaagc
atccaggacattgccgcatcagctgaagaacagcttgcttccatggaagaaatcagttcc
tcagcgacgactcttgcgcagatggcagaagagcttcgcgatctgacgaaacaatttaaa
atcgagtaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU33690
Entry
BSU33690          CDS       T00010                                 

Gene name
yvaQ
Definition
(RefSeq) sensory transducer protein YvaQ
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU33690 (yvaQ)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU33690 (yvaQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU33690 (yvaQ)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BSU33690 (yvaQ)
SSDB
Motif
Pfam: MCPsignal 4HB_MCP_1 HAMP TarH TMP_3 Laminin_II DUF948 CHASE3 CdvA DUF5304 MLD EzrA Mce4_CUP1
Other DBs
NCBI-GeneID: 938479
NCBI-ProteinID: NP_391249
Pasteur: BG14072
BSORF: BG14072
UniProt: O32239 A0A6M3ZJE1
Position
3458066..3459766
AA seq 566 aa
MRLTISRKFSLVFLTLILINLLVGGIGVLNMQHIIQKTDEINTKWIDGIKGITSINYVTE
HLSSKEKDFLIYTDKSKMDTLDQEMNQIMEDINQKLDNYEKTISTDKEQKLFEQLQTKVN
TYMDIHAQIIESGRTNDMDKARGLLVQTEASFEDMKKTITQLVDLNQEGSNTAVKETKAV
YHKGLIYTALLVAASILISIFIWLYITRNIVKPIIRMKESANHIAEGDLSNDMEALNSKD
ELGDLNEALQKMVGNLRDIVGYSKDISSRVLSSSQVLATATNETRSGSKHITETMNEMAE
GSEQQAQDAVTIAESMNEFTESIDKAYNHGITISDTSQNVLELAVSGNENMATSLQQMKT
IHHIVEEAVHKVRSLEQHSQDINKLVQVINGIAEQTNLLSLNAAIEAARAGESGKGFAVV
AEEVRKLADGVSDSVQDITRIVNGTQQEIHTVITYLESSFTEVEKGTENLTDTGQAMQHI
KQSVTHVADSIKEVTDGLKQLTNQSITINQSIENIASVSEESAAGIEETFSITEQSAHSM
DQVLLNAEELEQLANELNEKMGQFTI
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgcgactgacgatttcccgcaaattcagcctggtatttttgacactgatcctgatcaat
ttacttgtaggcggaataggcgttcttaatatgcagcatatcattcaaaaaacagatgaa
atcaacacaaaatggattgacggcatcaaaggaatcacttcaattaattatgtaaccgag
cacctgtcttctaaagaaaaggactttctgatttatacagacaaaagtaaaatggataca
cttgatcaagaaatgaatcaaatcatggaagacattaaccaaaagctcgataactacgaa
aaaacgatctccactgataaagagcagaaactgttcgagcagcttcaaactaaagtgaat
acctatatggatattcatgcgcaaattatcgaaagcggccgcacgaatgacatggacaaa
gcaagaggtttattggttcagactgaggccagctttgaggatatgaaaaaaacaatcact
cagcttgttgacttaaatcaagaaggcagcaacacagcggtaaaagaaacgaaggccgtc
tatcataaagggctcatttacactgctttgcttgtggcagcatcaatcctcatcagcatt
ttcatctggctttatatcacgcgaaacattgtaaagcctatcattcgcatgaaggaatct
gccaatcatattgccgaaggcgatttgtcgaacgatatggaggccctcaactcaaaagac
gagctgggtgatctgaatgaagcgctgcaaaaaatggtagggaatctgagagatattgtc
ggatattctaaagacatatcaagccgggttctttcttcttcacaggtgcttgcaaccgca
acgaatgaaacaagatccggcagcaaacatattaccgagacgatgaacgaaatggctgag
ggctctgaacagcaggcccaagacgcggtgacgattgccgaatcgatgaatgagtttacc
gaaagcattgataaagcctataatcacggcatcacaatcagcgatacgtctcaaaacgtt
ctcgaactcgcggtaagcgggaacgaaaatatggctacgtcattacagcaaatgaaaacc
atccatcatattgttgaagaagccgtgcataaagtgagatcactggaacagcattctcag
gatattaacaagctcgttcaggtcatcaacgggattgccgagcagacgaatttgctgtcc
cttaacgccgcgattgaagctgcccgcgctggagaaagcggcaaaggcttcgccgttgtg
gcagaggaggtcagaaagctggctgacggcgtttctgattccgtgcaggacattacccgg
attgtaaacgggacacagcaggagatccacactgtcattacgtacttggaaagcagcttt
acagaagtcgaaaaaggaacggaaaacctgacagacaccggacaggctatgcagcatatc
aaacaatccgtcacccatgttgcagacagcattaaggaagtaacggatggcttgaagcag
ttaacaaaccaatcgattaccatcaatcaatcgattgaaaatatcgcttctgtatccgaa
gagtctgccgccggcattgaagaaacattttcaattaccgagcaatccgcccattcgatg
gatcaagtgcttctaaatgctgaagagcttgagcagctggccaatgagcttaatgagaag
atgggtcagtttacgatttaa

DBGET integrated database retrieval system