KEGG   Bacillus subtilis subsp. subtilis 168: BSU04000
Entry
BSU04000          CDS       T00010                                 

Symbol
ycsA
Name
(RefSeq) tartrate dehydrogenase/decarboxylase
  KO
K07246  tartrate dehydrogenase/decarboxylase / D-malate dehydrogenase [EC:1.1.1.93 4.1.1.73 1.1.1.83]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00650  Butanoate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU04000 (ycsA)
   00650 Butanoate metabolism
    BSU04000 (ycsA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.83  D-malate dehydrogenase (decarboxylating)
     BSU04000 (ycsA)
    1.1.1.93  tartrate dehydrogenase
     BSU04000 (ycsA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.73  tartrate decarboxylase
     BSU04000 (ycsA)
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 938262
NCBI-ProteinID: NP_388282
Pasteur: BG11222
BSORF: BG11222
UniProt: P42958 A0A6M3ZAP4
Position
452830..453894
AA seq 354 aa
MTMKQFEIAAIPGDGVGKEVVAAAEKVLHTAAEVHGGLSFSFTAFPWSCDYYLEHGKMMP
EDGIHTLTQFEAVFLGAVGNPKLVPDHISLWGLLLKIRRELELSINMRPAKQMAGITSPL
LHPNDFDFVVIRENSEGEYSEVGGRIHRGDDEIAIQNAVFTRKATERVMRFAFELAKKRR
SHVTSATKSNGIYHAMPFWDEVFQQTAADYSGIETSSQHIDALAAFFVTRPETFDVIVAS
NLFGDILTDISSSLMGSIGIAPSANINPSGKYPSMFEPVHGSAPDIAGQGLANPIGQIWT
AKLMLDHFGEEELGAKILDVMEQVTADGIKTRDIGGQSTTAEVTDEICSRLRKL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgacgatgaaacaatttgagattgcggcaataccgggagacggagtaggaaaagaggtt
gtagcggctgctgagaaagtgcttcatacagcggctgaggtacacggaggtttgtcattc
tcattcacagcttttccatggagctgtgattattacttggagcacggcaaaatgatgccc
gaagatggaatacatacgcttactcaatttgaagcagtttttttgggagctgtcggaaat
ccgaagctggttcccgatcatatatcgttatgggggctgctgctgaaaatccggagggag
cttgagctttccattaatatgagacccgccaaacaaatggcaggcattacgtcgccgctt
ctgcatccaaatgattttgacttcgtggtgattcgcgagaacagtgaaggtgaatacagt
gaagttggcgggcgcattcacagaggcgatgatgaaatcgccatccagaatgccgtgttt
acgagaaaagcgacagaacgtgtcatgcgctttgccttcgaattggcgaaaaaacggcgc
agccatgtgacaagcgccacaaagtctaacggcatttatcacgcgatgccgttttgggat
gaagtctttcagcagacagccgctgattatagcggaatcgaaacatcatctcagcatatt
gatgcgctggccgctttttttgtgacgcgtccggaaacgtttgatgtcattgtggcgagc
aacttgttcggtgatattttaaccgacatcagctcaagcctgatgggaagcatcggcatt
gcgccttctgcgaacatcaatccatccggcaaatatccgtccatgtttgaaccggttcac
ggctcagctcctgacattgccggacagggccttgccaatccgatcggccagatttggaca
gcgaagctgatgctcgaccacttcggagaggaagaattgggggcgaaaattctggatgta
atggagcaagtgactgccgacggcatcaaaacacgcgacattgggggacaaagcacaacg
gctgaggtcactgatgaaatctgttcgcgcttaagaaagctctga

DBGET integrated database retrieval system