KEGG   Bacillus subtilis subsp. subtilis 168: BSU04010
Entry
BSU04010          CDS       T00010                                 

Gene name
sipU
Definition
(RefSeq) signal peptidase I U
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03060  Protein export
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU04010 (sipU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU04010 (sipU)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     BSU04010 (sipU)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S26: signal peptidase I family
   BSU04010 (sipU)
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24 PUA
Other DBs
NCBI-GeneID: 939966
NCBI-ProteinID: NP_388283
Pasteur: BG11223
BSORF: BG11223
UniProt: P42959 A0A6M3Z7Q4
Position
454029..454592
AA seq 187 aa
MNAKTITLKKKRKIKTIVVLSIIMIAALIFTIRLVFYKPFLIEGSSMAPTLKDSERILVD
KAVKWTGGFHRGDIIVIHDKKSGRSFVKRLIGLPGDSIKMKNDQLYINDKKVEEPYLKEY
KQEVKESGVTLTGDFEVEVPSGKYFVMGDNRLNSLDSRNGMGMPSEDDIIGTESLVFYPF
GEMRQAK
NT seq 564 nt   +upstreamnt  +downstreamnt
ttgaatgcaaaaacaatcacgttaaagaaaaaaagaaaaatcaaaacgatcgttgtactc
agtatcattatgatcgcagctctcatttttacgatcagattggtgttttacaagcctttt
cttattgaaggatcatcaatggccccaacgcttaaagactcagaaagaattctggttgat
aaagcagtcaaatggactggcgggtttcacagaggagacatcatagtcattcatgacaaa
aagagcggccgctcatttgtcaaacgtttaatcggtttgcctggtgacagcattaaaatg
aaaaatgatcagctatacataaatgataaaaaggtggaagaaccatacttaaaggaatat
aaacaggaggtcaaagagtcgggtgtaaccttaacaggtgacttcgaagttgaggttcct
tccggtaaatattttgtgatgggagataaccgtctcaattcactggatagcagaaacgga
atgggcatgccttctgaggacgatatcatcggtactgaatctctcgtcttttatccattc
ggtgagatgagacaggcaaaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU10490
Entry
BSU10490          CDS       T00010                                 

Gene name
sipV
Definition
(RefSeq) signal peptidase I V
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03060  Protein export
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU10490 (sipV)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU10490 (sipV)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     BSU10490 (sipV)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S26: signal peptidase I family
   BSU10490 (sipV)
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24
Other DBs
NCBI-GeneID: 939318
NCBI-ProteinID: NP_388930
Pasteur: BG12674
BSORF: BG12674
UniProt: O07560 A0A6M4JF00
Position
1122175..1122681
AA seq 168 aa
MKKRFWFLAGVVSVVLAIQVKNAVFIDYKVEGVSMNPTFQEGNELLVNKFSHRFKTIHRF
DIVLFKGPDHKVLIKRVIGLPGETIKYKDDQLYVNGKQVAEPFLKHLKSVSAGSHVTGDF
SLKDVTGTSKVPKGKYFVVGDNRIYSFDSRHFGPIREKNIVGVISDAE
NT seq 507 nt   +upstreamnt  +downstreamnt
atgaaaaaacggttttggtttcttgccggtgtagtgtccgttgttctcgccattcaggtt
aaaaatgctgtctttattgattacaaggtagaaggcgtcagtatgaacccgaccttccag
gaaggaaacgaattgttggtcaataaattttcgcatcgatttaaaaccatccatcgtttt
gacatcgtcctttttaaaggccctgatcataaagtgctgattaaacgggtaatcggcttg
cccggtgaaacgatcaaatataaagatgatcagctgtatgtgaacggaaagcaggttgct
gagccatttttgaagcatttgaaatctgtttctgccggcagccatgtaacgggtgatttt
tctttgaaagatgtgacgggaacaagcaaggtgccgaaaggaaaatattttgtcgttgga
gataatcgcatatacagcttcgacagccggcattttggtccgataagagaaaaaaatatt
gtcggtgtgatttctgatgccgaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU14410
Entry
BSU14410          CDS       T00010                                 

Gene name
sipT
Definition
(RefSeq) signal peptidase I T
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03060  Protein export
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU14410 (sipT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU14410 (sipT)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     BSU14410 (sipT)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S26: signal peptidase I family
   BSU14410 (sipT)
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24 AMP-binding
Other DBs
NCBI-GeneID: 938763
NCBI-ProteinID: NP_389324
Pasteur: BG11977
BSORF: BG11977
UniProt: P71013 A0A6M3ZFL7
Position
1511308..1511889
AA seq 193 aa
MTEEKNTNTEKTAKKKTNTYLEWGKAIVIAVLLALLIRHFLFEPYLVEGSSMYPTLHDGE
RLFVNKTVNYIGELKRGDIVIINGETSKIHYVKRLIGKPGETVQMKDDTLYINGKKVAEP
YLSKNKKEAEKLGVSLTGDFGPVKVPKGKYFVMGDNRLNSMDSRNGLGLIAEDRIVGTSK
FVFFPFNEMRQTK
NT seq 582 nt   +upstreamnt  +downstreamnt
ttgaccgaggaaaaaaatacgaatactgagaaaacggcgaagaaaaaaaccaatacgtac
ctggaatggggtaaagcgattgtcatcgctgttctgctggctctcctgatccgtcacttt
ttgtttgaaccgtatttagttgaaggttcatctatgtatcccacattacatgacggagaa
aggctgtttgtgaataaaacagtcaactatatcggcgagctgaagcgcggagatatcgtt
attatcaacggtgaaacttctaaaatccattatgtaaaaagattgatcggaaagcctgga
gaaaccgttcaaatgaaggatgacacgctttatataaacggtaaaaaagtagccgagcct
tacttgtctaaaaacaagaaggaagcagaaaaacttggtgtcagtctgacaggagacttt
ggaccggttaaggttccgaaaggcaaatactttgtcatgggagataaccggctgaattct
atggacagccgaaacgggctgggactgatcgcggaagatcgaattgtcggcacatcgaag
tttgtctttttcccgtttaacgaaatgcgtcaaacaaaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU23310
Entry
BSU23310          CDS       T00010                                 

Gene name
sipS
Definition
(RefSeq) signal peptidase I S
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03060  Protein export
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU23310 (sipS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU23310 (sipS)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     BSU23310 (sipS)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S26: signal peptidase I family
   BSU23310 (sipS)
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24
Other DBs
NCBI-GeneID: 938944
NCBI-ProteinID: NP_390212
Pasteur: BG10515
BSORF: BG10515
UniProt: P28628 A0A6M4JNL5
Position
complement(2432316..2432870)
AA seq 184 aa
MKSENVSKKKSILEWAKAIVIAVVLALLIRNFIFAPYVVDGDSMYPTLHNRERVFVNMTV
KYIGEFDRGDIVVLNGDDVHYVKRIIGLPGDTVEMKNDQLYINGKKVDEPYLAANKKRAK
QDGFDHLTDDFGPVKVPDNKYFVMGDNRRNSMDSRNGLGLFTKKQIAGTSKFVFYPFNEM
RKTN
NT seq 555 nt   +upstreamnt  +downstreamnt
ttgaaatcagaaaatgtttcgaagaaaaagtcaatattagaatgggcaaaagcaattgtg
attgctgtcgttcttgctttgctcatccgcaactttatttttgcgccgtatgtcgttgat
ggtgactctatgtatcctacacttcacaaccgtgaaagggtttttgttaatatgacagtc
aaatacatcggcgagtttgatagaggagacatcgtcgtgttaaacggagatgatgttcac
tatgtcaaacgtattatcggccttcccggcgatacggttgagatgaaaaatgaccagctc
tatatcaacgggaaaaaggtggacgaaccttatttggcggctaataaaaagagagcgaaa
caggacggttttgaccatttgaccgatgatttcggcccggttaaagtgcctgataacaag
tattttgtgatgggtgacaatcgtcgcaattccatggacagccgtaacggccttggcctc
ttcacgaaaaaacaaattgcgggtacgtcaaagtttgttttctacccgtttaacgaaatg
cgcaaaacaaattag

DBGET integrated database retrieval system