KEGG   Bacillus subtilis subsp. subtilis 168: BSU04040
Entry
BSU04040          CDS       T00010                                 

Symbol
ycsE
Name
(RefSeq) hypothetical protein
  KO
K21064  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase [EC:3.1.3.104]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00740  Riboflavin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU04040 (ycsE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.104  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
     BSU04040 (ycsE)
SSDB
Motif
Pfam: Hydrolase_3 S6PP Hydrolase HAD_2 HAD Hydrolase_6 Acid_phosphat_B
Other DBs
NCBI-GeneID: 938252
NCBI-ProteinID: NP_388286
Pasteur: BG11226
BSORF: BG11226
UniProt: P42962 A0A6M4JCX7
Position
456068..456817
AA seq 249 aa
MSVQREDVDIKLIAIDMDGTLLNDEQLISDENRKAIREAEDKGVYVVISTGRTLMTCREL
AESLKLSSFLITANGSEIWDSNFNLVERKLLHTDHIQMMWDLRNKHNTNFWASTVNKVWR
GEFPENITDHEWLKFGFDIEDDDIRNEVLEELRKNKELEITNSSPTNIEVNALGINKAAA
LAKVTEKLGFTMENVMAMGDSLNDIAMIKEAGLGVAMGNAQDIVKETADYITDTNIEDGV
AKAIRHWVL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgtctgttcaaagagaagatgtagatatcaagctgatcgcaattgatatggatggtaca
ctgctgaacgacgagcagctgatctcggatgaaaaccgcaaagccattcgtgaagcggag
gataaaggtgtgtatgtggtgatcagcacgggccggacgctgatgacgtgcagggagctg
gcggaatcgctaaagctgtcatcctttctaatcacggcaaacggcagtgaaatttgggat
tcgaattttaatttggtggaacggaagctgcttcatacggaccatattcaaatgatgtgg
gatttgcggaataagcacaacactaatttctgggcttctacggtgaataaagtatggaga
ggcgagtttccggaaaacattacggatcatgaatggctcaaattcggctttgacatcgag
gatgacgatatccgaaacgaagtgcttgaggagctgagaaaaaacaaagagctcgaaatc
acaaattcaagtccgacaaacattgaagtcaacgcgcttggcatcaacaaagctgcagcc
cttgccaaggttacggaaaaactcggctttacaatggagaatgtgatggcgatgggcgac
agccttaatgacattgcgatgatcaaagaagcgggtcttggcgtcgcaatgggcaatgcg
caagacatcgtaaaagaaacggctgattatatcacggatacaaatattgaggatggtgtc
gctaaagcgattcgccattgggtactataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU11140
Entry
BSU11140          CDS       T00010                                 

Symbol
yitU
Name
(RefSeq) phosphatase YitU
  KO
K21064  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase [EC:3.1.3.104]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00740  Riboflavin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU11140 (yitU)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.104  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
     BSU11140 (yitU)
SSDB
Motif
Pfam: Hydrolase_3 S6PP HAD Hydrolase Trehalose_PPase Hydrolase_6
Other DBs
NCBI-GeneID: 939795
NCBI-ProteinID: NP_388995
Pasteur: BG12245
BSORF: BG12245
UniProt: P70947 A0A6M3Z9K6
Position
complement(1190490..1191302)
AA seq 270 aa
METKPYLIALDLDGTLLKDDKTISENTLHTIQRLKDDGHYVCISTGRPYRSSSMYYQQME
LTTPIVNFNGAFVHHPQDDSWGRYHTSLPLDVVKQLVDISESYNVHNVLAEVIDDVYFHY
HDEHLIDAFNMNTTNVTVGDLRENLGEDVTSVLIHAKEEDVPAIRSYLSDVHAEVIDHRR
WAAPWHVIEIIKSGMNKAVGLQKISDYYGVPRERIIAFGDEDNDLEMLEFAGCGVAMGNG
IDAVKQIANRTTATNEEDGVARFLKEYFSL
NT seq 813 nt   +upstreamnt  +downstreamnt
atggagacaaaaccctatttaatcgcattagatttagatggaacattattaaaggatgat
aaaaccatatctgaaaacacccttcatacgatacagcgcctaaaagatgacgggcattat
gtctgcatctcaacaggccgtccgtatcgttcaagttccatgtactaccagcagatggag
ctgacaacgccaattgtcaattttaacggagcatttgtccatcatccgcaagacgacagc
tggggacggtatcatacgtcactgccgcttgatgttgtcaaacagctcgtggatatcagc
gagagctacaacgtacataacgtgcttgctgaagtgattgacgacgtatactttcattac
catgatgagcacctgatagatgcctttaacatgaacacaacaaatgtaacggtcggagac
ttgcgggaaaatctcggtgaagatgtgacgtccgtactcatacatgcaaaggaagaggat
gtgccggcaatacgctcatatttatcggatgtgcatgccgaggtgatcgaccatagaaga
tgggccgctccttggcatgtcattgaaattatcaaaagcggcatgaataaagcggtcggc
ctgcagaaaatcagcgattattacggcgtgccgagggagcggatcattgcttttggagat
gaggataacgatttggaaatgcttgaatttgcaggctgcggcgttgcaatgggaaatgga
attgacgcggtcaagcagattgccaaccgaactacggccacaaatgaagaggacggcgtg
gcaaggtttttgaaagaatatttctcactttaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU35850
Entry
BSU35850          CDS       T00010                                 

Symbol
ywtE
Name
(RefSeq) hypothetical protein
  KO
K21064  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase [EC:3.1.3.104]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00740  Riboflavin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU35850 (ywtE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.104  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
     BSU35850 (ywtE)
SSDB
Motif
Pfam: Hydrolase_3 S6PP Hydrolase HAD Trehalose_PPase HAD_2
Other DBs
NCBI-GeneID: 936824
NCBI-ProteinID: NP_391466
Pasteur: BG12536
BSORF: BG12536
UniProt: P96741 A0A6M4JPT0
Position
3695363..3696223
AA seq 286 aa
MKCIAIDLDGTLLNKESVISAENREAIKRAVDAGILVTICTGRATFDVKALLDDLDIPII
AANGGTIHDTGYRLISRTLMDQEAGKAIADYLLSKNIYFEVYTDDHLLSPFDGEAKLHAE
LDILKSANPNEQTDDLWQGAMTQFKQFGIKPIPHIESVFDGGENIYKLLCFSFDMDKLKQ
AKEELKHHKKLAQTSSGKHIIEILPASSGKGRALTKLADIYGIETQDIYAIGDSPNDLSM
FEVAGHRIAMENAIDELKEKSTFVTKSNDENGVAYFIDQLLSGQYA
NT seq 861 nt   +upstreamnt  +downstreamnt
atgaaatgtattgcgattgatctagacggaacattactgaataaagaaagcgtcatttct
gcggaaaacagagaggcgatcaagcgggccgttgatgccggcatcctcgtcaccatttgc
acgggaagagcgacatttgatgtaaaagcgctgctggatgacttggacatccctatcatt
gcagctaatggcggtacgatccacgacacgggttaccgtttgatcagccggacattaatg
gatcaggaagccggtaaagcgattgctgattacttactttcaaaaaacatttactttgag
gtatatacagatgaccatctgctttctccttttgacggcgaagctaagctgcacgcggag
cttgacattctaaagagcgcaaacccaaacgagcagacggatgacttgtggcaaggagcc
atgactcaattcaaacagtttggcattaaaccaatccctcatatcgaatcggtttttgac
ggcggtgaaaacatttataagcttctttgcttctcctttgatatggacaagctgaaacaa
gcgaaggaagaactgaagcatcataaaaaactggcgcaaacctcttcaggaaaacatatt
atcgaaatcctgccggcctcgtcaggaaaaggacgcgcgttaacaaagctggctgacata
tacggaattgaaacacaggatatctatgcgatcggcgatagtccaaacgatttgtccatg
tttgaagtcgccggacaccgtatcgccatggaaaatgcgattgatgaattaaaagaaaaa
agcacctttgtcacaaaaagcaatgacgaaaatggtgtggcctactttatagaccagctt
ctttcggggcaatatgcataa

DBGET integrated database retrieval system