KEGG   Bacillus subtilis subsp. subtilis 168: BSU04570
Entry
BSU04570          CDS       T00010                                 

Symbol
murF
Name
(RefSeq) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00300  Lysine biosynthesis
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
bsu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BSU04570 (murF)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU04570 (murF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BSU04570 (murF)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     BSU04570 (murF)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase Glyco_hydro_30 VMAP-C
Other DBs
NCBI-GeneID: 939947
NCBI-ProteinID: NP_388338
Pasteur: BG12084
BSORF: BG12084
UniProt: P96613 A0A6M4JIN4
Position
509384..510757
AA seq 457 aa
MIKRTVKNIAEMVKGTLANPQYEQTVIHGVATDTRKLEQHQLFIPLKGERFDGHSFVEQA
FEAGVAAVLWDRSVPNPPENHAVILVDDTLTALQQLAKAYLQELGTRVIGVTGSNGKTTT
KDMIHAVLGTQYRVHKTGGNFNNHIGLPLTVLAMPENTEIAVLEMGMSAKGEIDLLSRLA
NPDAAVITNIGESHMQDLGSREGIAEAKLEIINGLKEDGVLIYIGDEPLLQNAYSCQTKT
YGTGTHNDYQLQDVSQSEEGTHFTIKGIENTFFIPILGKHNVMNAMAAIAAGAYFGIAPE
DAAKGLSGLKVTGMRLELIKTDSGLSIINDAYNASPTSMKAAIQLTESLEGYGKKMLVLG
DMLELGDLEETFHKECGAVISPDKIDRVFTYGKLGAFIAEGALKHFEKDRVSHYTEKKDL
LQAVKENASKGDLILFKASRGMKLEEIVKDLIESPLS
NT seq 1374 nt   +upstreamnt  +downstreamnt
ttgattaagcgaacagtaaaaaacattgccgaaatggttaaaggcacactagcaaatccg
caatatgaacaaacagtcattcatggagtggcaaccgatacaagaaaactggaacaacat
cagctctttattccgctgaaaggggaacgttttgacggccactcttttgtggagcaggcc
tttgaagctggtgtagcggctgttctttgggatcggtcagtaccaaatccgcccgagaat
cacgccgtcattttagtggacgatacccttactgcacttcagcagcttgcaaaagcttat
ttgcaggagcttggcacgcgtgtcatcggagtaaccggaagcaatggcaaaacgacaaca
aaagatatgattcacgccgtattggggacccagtaccgtgtccacaaaactggaggaaac
ttcaataatcatatcggtttgccgctgacggttttagcgatgcctgaaaatacggagatc
gccgtattggagatgggaatgagcgccaaaggagaaattgacctcttgagccgactggca
aacccggatgcggcagtgattacgaatatcggcgaatcgcatatgcaagacctcggctct
agagagggcatcgcggaggcgaagcttgaaatcataaacgggcttaaagaagacggagtg
ctgatttatatcggggacgaaccgcttcttcaaaatgcatacagctgccagacgaaaacg
tacggtacgggaacgcataatgattatcagcttcaggatgtcagccagagtgaggaagga
acccattttacaatcaaagggatagaaaacacgttttttattccaatactcggcaagcac
aatgtgatgaacgccatggctgcaattgctgcaggggcttattttggcatcgcgcctgag
gatgcggcaaaaggactgagcggcctaaaggtaaccgggatgaggcttgaactcatcaaa
acagacagcggcctttcgataatcaatgacgcttataatgcgagcccgacttccatgaaa
gctgcaattcaattgacagaaagccttgaaggctacggcaaaaaaatgctcgtgctcggt
gatatgcttgaactcggcgatcttgaagaaacgttccataaagagtgcggcgctgtgatc
agccctgataaaattgaccgcgtctttacgtacggaaaactgggagcttttatcgcggaa
ggcgccctgaaacactttgagaaagaccgcgtcagccattacactgagaaaaaagatctc
cttcaagctgtgaaggaaaacgcatcaaaaggcgatttgattttattcaaagcgtccaga
ggtatgaagcttgaagaaatcgttaaagatttaatagagagcccgctttcataa

DBGET integrated database retrieval system