KEGG   Bacillus subtilis subsp. subtilis 168: BSU04580
Entry
BSU04580          CDS       T00010                                 

Symbol
cshA
Name
(RefSeq) ATP-dependent RNA helicase
  KO
K05592  ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU04580 (cshA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU04580 (cshA)
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU04580 (cshA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     BSU04580 (cshA)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     BSU04580 (cshA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA helicases
   BSU04580 (cshA)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII Helicase_RecD CMS1
Other DBs
NCBI-GeneID: 938170
NCBI-ProteinID: NP_388339
Pasteur: BG12085
BSORF: BG12085
UniProt: P96614 A0A6M4JD28
Position
511106..512641
AA seq 511 aa
MVNHDITETAIRRSLNNLTITFQDFNLSSDLMKAINRMGFEEATPIQAQTIPLGLSNKDV
IGQAQTGTGKTAAFGIPLVEKINPESPNIQAIVIAPTRELAIQVSEELYKIGQDKRAKVL
PIYGGQDIGRQIRALKKNPNIIVGTPGRLLDHINRRTIRLNNVNTVVMDEADEMLNMGFI
DDIESILSNVPSEHQTLLFSATMPAPIKRIAERFMTEPEHVKVKAKEMTVSNIQQFYLEV
QERKKFDTLTRLLDIQSPELAIVFGRTKRRVDELAEALNLRGYAAEGIHGDLTQAKRMVA
LRKFKEGAIEVLVATDVAARGLDISGVTHVYNFDVPQDPESYVHRIGRTGRAGKTGMAMT
FITPREKSMLRAIEQTTKRKMDRMKEPTLDEALEGQQQVTVERLRTTISENNLNFYMTAA
AELLEDHDAVTVVAAAIKMATKEPDDTPVRLTDEAPMVSKRYKNQRSSKRRDGQGGGYRG
GKGKSNNRSSYDKKRSNDRRSSGDRRQKKSY
NT seq 1536 nt   +upstreamnt  +downstreamnt
gtggtaaatcacgacattactgaaacagcaattagaaggagtttgaataatttgactata
acgtttcaagattttaatttaagttctgatctcatgaaagcaattaatcgtatgggattt
gaagaagcaacaccgattcaggcacaaacgataccgctcggactttcaaataaagacgtc
attggacaagcgcaaacaggtacaggtaaaacagctgcgtttggtataccccttgttgaa
aaaattaaccccgagtctcctaatattcaagcaatcgtaatcgcgccaacccgtgaatta
gccattcaagtatctgaagaattgtataaaatcggacaagataaacgtgcgaaggttctt
cctatttacggcggacaggatattggacggcaaatccgggcgttaaagaagaatccgaat
attattgtcggaacacctggacgtcttcttgaccacatcaaccgccgcaccattcgttta
aacaatgtaaataccgttgtaatggatgaagcggatgaaatgctgaacatgggattcatt
gacgatattgaatctatcctttcaaacgtgccaagcgagcatcagacacttctgttctct
gccacaatgcctgcgccgatcaaacgcattgcagagcgcttcatgactgagccggaacac
gtaaaagtaaaagcgaaagaaatgacggtttctaacattcagcagttctatttggaagtg
caagaacgtaaaaaattcgatacactgactcgccttcttgatattcagtctcctgagctt
gcgatcgtattcggacgtacaaaacgccgtgtcgatgagctggctgaagctctgaacctt
cgcggatatgcagctgaaggtattcacggtgacttaacgcaggcgaaacgtatggttgcg
cttcgtaaatttaaagaaggcgcaatcgaagttctagtcgcaactgatgttgccgctcgc
ggacttgatatctcaggtgttacacacgtatacaacttcgacgtgcctcaagatcctgaa
agctacgttcaccgtatcggaagaacgggccgtgcaggaaaaacaggtatggcgatgacg
ttcattacaccgcgtgagaaaagcatgcttcgcgcaattgaacaaacaacaaaacgcaaa
atggaccgcatgaaggagcctacacttgatgaagcgttagaaggtcagcaacaggttact
gttgaacgtcttcgcacaacaatcagtgaaaacaacctgaacttctacatgacagcggca
gctgagctgcttgaagatcatgatgcagtaacagtggttgcggcggctatcaaaatggct
acaaaagagccagacgacacaccggttcgcttaacagacgaagcgccgatggtcagcaaa
cgctacaagaaccagcgctcttctaaacgcagagacggtcaaggcggcggctaccgcggc
ggaaaagggaaaagcaacaaccgttcttcctatgacaaaaagcgttcaaacgatcgccgt
tcttcaggtgacagacgccagaaaaaatcttactaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU19220
Entry
BSU19220          CDS       T00010                                 

Symbol
yocI
Name
(RefSeq) ATP-dependent DNA helicase RecQ
  KO
K03654  ATP-dependent DNA helicase RecQ [EC:5.6.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU19220 (yocI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU19220 (yocI)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU19220 (yocI)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     BSU19220 (yocI)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     BSU19220 (yocI)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      BSU19220 (yocI)
SSDB
Motif
Pfam: RQC HRDC Helicase_C DEAD RecQ_Zn_bind ResIII Helicase_Sgs1
Other DBs
NCBI-GeneID: 939671
NCBI-ProteinID: NP_389803
Pasteur: BG13522
BSORF: BG13522
UniProt: O34748 A0A6M3ZBW7
Position
complement(2094010..2095785)
AA seq 591 aa
MLHRAQSLLAHYFGYEKFRSGQDEAIRLVTEARQNTACIMPTGGGKSICYQIPALMFEGT
TIVISPLISLMKDQVDALEEAGINAAYINSTQSNQEIYERLNGLKEGAYKLFYITPERLT
SIEFIRILQGIDVPLVAIDEAHCISQWGHDFRPSYRNIEILFRELHDKPVIMALTATATP
EVHDDICKQLHIQKENTVYTGFSRENLTFKVVKGENKDRFIDEYVQNNRHEAGIVYTATR
KEADRIYERLKRNQVRAGRYHGGLADDVRKEQQERFLNDELQVMVATSAFGMGIDKSNIR
FVLHAQIPKDMESYYQEAGRAGRDGLASECVLLFSPQDIMVQRFLIEQSEHEEKQKQDLK
KLRQMVDYCHTEDCLQRFILMYFGEKEPDACGQCGNCTDTRAAHDVTREAQMVLSCIIRM
KERFGKTMVAQVLAGSKNKKVLENGFSDLSTYGILKHQSVGEISDFIEFLISDDFIRMSD
GTFPTLFVSSKGRNVLKGELSVARKEALKAAAITENDELFERLRMVRKEIAAEQGVPPFV
VFSDQTLKEMSGKQPVNDDELLSIKGVGEQKRAKYGRLFLQEIQAYARMTD
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgttacatagagcccaatcccttctggctcattattttggttatgagaagtttcggagc
ggccaagatgaagcgatccgcttggtgacggaagcgaggcaaaatacggcctgcattatg
ccgacgggaggcggcaaatcgatttgctatcagattccggcattaatgtttgaagggacg
acgatcgtcatttcaccgttgatttccttgatgaaggatcaagttgatgcgttagaagaa
gcggggattaacgccgcctacattaacagcacacaatccaatcaggaaatatatgagagg
ctgaacggactcaaagaaggggcttataagcttttttacattacaccagagcgactaacg
tccatagagtttatccggattttgcagggcatagatgttcctttggtcgcaatagacgag
gcgcattgtatttctcaatggggccatgatttcaggccaagctacaggaatattgaaatc
ttgttccgtgaattacacgacaagcctgtcatcatggcgttaacagcaacagccacaccc
gaggttcatgatgatatttgcaaacagctgcatattcaaaaagaaaacacggtatatacc
ggattttcccgagagaatttaacctttaaagtagtaaaaggagaaaataaagatcggttt
atagacgaatatgtgcaaaacaacaggcatgaagcaggaattgtctatacagcgaccaga
aaagaagctgatcggatatatgagagattgaaacgaaatcaggtcagggcaggccggtat
catggaggtttggctgatgatgtgagaaaagagcagcaggaaagatttcttaatgatgag
cttcaagtgatggtggcaacctctgcttttggaatgggtattgataaatcaaatatcaga
tttgttctgcatgcacaaatcccgaaagatatggaaagctattatcaagaggcaggacga
gctggacgggacggtcttgccagtgaatgtgttctcctgttttcaccgcaggatattatg
gtgcagcgcttcttaattgagcaatcagaacatgaagagaaacaaaagcaggatttaaaa
aagctgagacaaatggtcgactactgtcatacggaagattgtctgcagcgttttatcctt
atgtatttcggagaaaaggagcctgatgcgtgcggacagtgcggaaactgtaccgataca
agagcggcccatgacgtgacgcgggaggcgcaaatggtcttatcttgtatcattcgcatg
aaagaacggtttggcaagacgatggttgcccaggtgcttgccggctccaaaaataaaaaa
gttcttgaaaacggcttttccgacctttcaacatacgggatattaaaacaccaatccgtt
ggcgaaatcagtgattttatcgaatttcttatttctgacgacttcatcaggatgtcagac
ggaacgtttccgactctttttgtcagcagtaaaggaaggaatgtgctgaaaggagaatta
tcagtagcgagaaaagaagcgttaaaagcggcagcgattactgaaaatgacgagctattt
gaacgattgcgcatggttcggaaagaaattgcggctgagcagggtgttccgccatttgtt
gttttctctgaccaaacgttaaaagaaatgtcaggaaaacagcccgtaaatgatgatgaa
cttttgtctataaaaggagtcggagaacaaaaaagagcaaaatacggccggcttttttta
caagaaatacaggcttatgcaaggatgacagactaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU23020
Entry
BSU23020          CDS       T00010                                 

Symbol
recQ
Name
(RefSeq) ATP-dependent DNA helicase RecS
  KO
K03654  ATP-dependent DNA helicase RecQ [EC:5.6.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU23020 (recQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU23020 (recQ)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU23020 (recQ)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     BSU23020 (recQ)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     BSU23020 (recQ)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      BSU23020 (recQ)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII RecQ_Zn_bind SNF2-rel_dom DUF6119
Other DBs
NCBI-GeneID: 938969
NCBI-ProteinID: NP_390183
Pasteur: BG11407
BSORF: BG11407
UniProt: P50729 A0A6M3ZDE4
Position
complement(2406922..2408412)
AA seq 496 aa
MTKLQQTLYQFFGFTSFKKGQQDIIESILSGKDTIAMLPTGGGKSLCYQLPGYMLDGMVL
IVSPLLSLMEDQVQQLKARGEKRAAALNSMLNRQERQFVLEHIHRYKFLYLSPEALQSPY
VLEKLKSVPISLFVIDEAHCISEWGHDFRPDYSKLGQLRKKLGHPPVLALTATATKETLQ
DVMNLLELQHAVRHLNSVNRPNIALRVENAADTAEKIDRVIQLVENLQGPGIVYCPTRKW
AKELAGEIKSKTSSRADFYHGGLESGDRILIQQQFIHNQLDVICCTNAFGMGVDKPDIRY
VIHFHLPQTAEAFMQEIGRAGRDGKPSVSILLRAPGDFELQEQIIQMESVTAEEIADVIR
VLEKTEERDERRLRDVLLQYGVGETQARMMIHLFMQGKTSVELMKKEISYRMELKLEKMH
RVSFLLQRDGCLRQALLTYFDESYEPDDGNLPCCSHCGFDLSLYEQKGERSKMAPLDSWS
SELHRIFSLQTVGELN
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgactaaattacagcaaacgttatatcagttttttggttttacttcctttaaaaaaggg
cagcaggacattattgaaagcatactcagcgggaaggataccattgcaatgctcccgact
gggggagggaaatcgctttgctaccagctgcctggttatatgcttgatggcatggtatta
atcgtttctccactgctttctttaatggaggatcaggtgcagcagctcaaagcccggggg
gaaaagcgtgctgcagctttgaacagcatgcttaacaggcaggaaagacaatttgtttta
gaacatattcatcgatataaatttttgtacttgtctcctgaagctttacagtctccatat
gtattggaaaaattgaaaagcgttccgattagcctatttgttattgacgaagcgcattgt
atttctgaatggggacacgacttcaggcctgattattcaaagctcggacagctgagaaaa
aaacttggacacccacccgttctggcattgaccgccacggctacaaaggaaacgctgcaa
gatgtcatgaacctgctggagctgcagcatgctgtacgccatctcaactcagtcaaccgc
ccaaacatcgcactgagggttgaaaatgcggcggatactgccgaaaaaatagatagggtc
attcagctggttgaaaacctgcaaggtccgggaattgtttattgtccaacacggaaatgg
gctaaggaattagcgggtgaaattaaaagcaaaacgagcagcagagccgacttttaccat
ggcggtttggagtcaggggacaggattttaattcagcagcagtttattcataaccagctt
gatgtgatatgttgtacgaatgcgtttggaatgggtgtcgataaacctgatatcagatat
gtgattcattttcatctcccgcagacggcagaagcttttatgcaggaaatcggcagagcg
ggacgcgacggaaagccgagtgtcagcattttgctgcgggcgccaggggattttgaattg
caggaacaaattatccagatggagagtgtcacagctgaagaaatcgccgacgtaatccgt
gtgctagagaagacggaggagcgggatgagagaaggctgcgtgacgtattacttcagtat
ggcgtcggagagacacaggcccgtatgatgattcatctctttatgcagggaaaaacatca
gttgaactgatgaagaaagaaatttcatatcgcatggagctgaagctggaaaaaatgcac
cgtgtatcatttttgcttcagcgtgacggctgtttaaggcaggcactgttaacctacttt
gatgaatcatacgagcctgatgacggaaacctcccgtgctgttcacattgcggttttgat
ttatccttgtatgaacaaaaaggggaacggagtaaaatggcgccattagacagctggagt
tcggaattgcaccggatattcagcttgcagactgtaggtgagctgaactga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU39110
Entry
BSU39110          CDS       T00010                                 

Symbol
deaD
Name
(RefSeq) ATP-dependent RNA helicase DbpA
  KO
K05592  ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU39110 (deaD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU39110 (deaD)
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU39110 (deaD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     BSU39110 (deaD)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     BSU39110 (deaD)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA helicases
   BSU39110 (deaD)
SSDB
Motif
Pfam: DEAD Helicase_C DbpA ResIII AAA_19 CMS1 Helicase_RecD
Other DBs
NCBI-GeneID: 937492
NCBI-ProteinID: NP_391790
Pasteur: BG11143
BSORF: BG11143
UniProt: P42305 A0A6M4JQQ3
Structure
Position
complement(4015987..4017426)
AA seq 479 aa
MSHFKNYQISHDILRALEGLGYTEPTKVQQSVIPAALERKDLVVKSQTGSGKTASFGIPL
CELANWDENKPQALILTPTRELAVQVKEDITNIGRFKRIKATAVFGKSSFDKQKAELKQK
SHIVVGTPGRVLDHIEKGTLPLDRLSYLVIDEADEMLNMGFIEQVEAIIKHLPTERTTML
FSATLPQDIEKLSRQYMQNPEHIEVKAAGLTTRNIEHAVIQVREENKFSLLKDVLMTENP
DSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRFDVMNEFKRGEYRYLVATDVA
ARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFVTAFEKRFLADIEEYIG
FEIQKIEAPSQEEVARKKPEFLAKLNDRPESKKDKSEELNKDIMKLYFNGGKKKKIRAVD
FVGTIAKIDGVSADDIGIITIMDNASYVEILNGKGPHVLKVMKNTTVKGKQLKVNKANK
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagtcattttaaaaactatcaaatcagtcatgacattttacgagcattggaaggactg
ggatatacagaaccgaccaaggtgcagcagagtgtgatccccgctgcccttgaacgaaag
gatcttgtcgtcaaatcacagacaggaagcgggaaaacggcttcgttcgggattcctctc
tgtgagctggcgaattgggatgaaaacaagccgcaggcgcttattttaacaccgacccgt
gagcttgcggtgcaagtaaaggaagatatcacgaacatcggacgatttaaacggatcaaa
gcgacagccgtatttggaaaatcctcctttgataaacaaaaagctgagcttaagcaaaaa
agccacattgttgtcggcacgccgggacgtgttctggatcatatcgaaaaaggcacgctg
ccgttggatcgtctctcttatttggtcattgatgaagcggatgagatgctgaatatgggc
ttcattgagcaggtggaggcgattatcaagcatctgccgactgagcgtacgacgatgctg
ttttcagcgacgcttccgcaggatatcgagaagctgagccgtcaatatatgcaaaacccc
gagcatatcgaggtcaaagcggccggcctaaccacaagaaatattgaacatgcggtgatt
caagtaagagaagagaataagttttcattgctgaaagatgtgctgatgacggagaatccc
gacagctgcatcattttctgccgaacgaaggagcacgtcaatcagctgaccgatgaattg
gatgacttgggatatccatgcgataaaattcacggcggaatgattcaggaagaccgattc
gacgtcatgaatgaatttaaacgtggcgagtaccgttacttagtggcgacggatgtcgcc
gcgcgcgggattgatattgaaaatatctcccttgtcatcaactatgatctgccgcttgaa
aaagaaagctatgtccaccgcacgggccgaacgggacgcgcagggaacaaaggaaaggcc
atttcgtttgtcacggccttcgaaaaacggtttttagccgacattgaagaatatatcgga
tttgaaatccaaaaaatagaagcaccttctcaagaggaagtggcaaggaagaaaccagaa
tttctagctaaactgaatgaccgtccggaaagcaaaaaggacaaaagcgaagagctgaat
aaagacattatgaagctgtattttaacggcggaaagaaaaagaaaatcagagccgttgat
tttgtaggaacgattgccaaaattgacggtgtgtcagctgacgacatcggcatcatcacg
atcatggataacgcctcatacgttgagattttaaatggtaaaggccctcatgttctcaaa
gtgatgaagaacacaaccgtcaaagggaaacagctgaaggtgaataaagcgaataaatga

DBGET integrated database retrieval system