KEGG   Bacillus subtilis subsp. subtilis 168: BSU04620
Entry
BSU04620          CDS       T00010                                 

Gene name
acpS
Definition
(RefSeq) holo-[acyl-carrier-protein] synthase
  KO
K00997  holo-[acyl-carrier protein] synthase [EC:2.7.8.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU04620 (acpS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.7  holo-[acyl-carrier-protein] synthase
     BSU04620 (acpS)
SSDB
Motif
Pfam: ACPS 4PPT_N
Other DBs
NCBI-GeneID: 938194
NCBI-ProteinID: NP_388343
Pasteur: BG12089
BSORF: BG12089
UniProt: P96618 A0A6M4JFL5
Structure
PDB: 
1F7L 1F7T 1F80

Position
515710..516075
AA seq 121 aa
MIYGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAF
SKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSQAAVHVSITHTKEYAAAQVVIERLS
S
NT seq 366 nt   +upstreamnt  +downstreamnt
atgatttacggcattgggctggacattaccgagcttaaacggatcgcctctatggctggg
cgccagaaaaggtttgccgagcggattttgacgcgaagcgagcttgaccaatactatgag
ctttcagagaaaagaaaaaacgaatttctcgcgggcagattcgcggcaaaagaagcgttc
tcgaaagcatttggcaccggcattgggaggcagctcagctttcaggacattgaaattagg
aaagaccaaaatggcaagccctatatcatttgtacgaaactgagccaggccgccgttcac
gtatcgatcactcatacaaaagaatacgctgccgcgcaggttgtgattgaaaggttgtca
agctag

DBGET integrated database retrieval system