KEGG   Bacillus subtilis subsp. subtilis 168: BSU05810
Entry
BSU05810          CDS       T00010                                 

Symbol
gmuB
Name
(RefSeq) PTS system-oligo-beta-mannoside-specific transporter subunit IIB
  KO
K02760  cellobiose PTS system EIIB component [EC:2.7.1.196 2.7.1.205]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU05810 (gmuB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU05810 (gmuB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU05810 (gmuB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     BSU05810 (gmuB)
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     BSU05810 (gmuB)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU05810 (gmuB)
SSDB
Motif
Pfam: PTS_IIB
Other DBs
NCBI-GeneID: 938018
NCBI-ProteinID: NP_388462
Pasteur: BG12190
BSORF: BG12190
UniProt: O05505 A0A6M3Z823
Position
626622..626933
AA seq 103 aa
MKKILLACSSGMSTSLLVTKMKEYAQSIGEEAEIWAVGQDKAKEDMRKADAVLIGPQMSF
LKSELQKEADQYNIQVEVIDMMAYGMADGKKAYEQALSLMVNQ
NT seq 312 nt   +upstreamnt  +downstreamnt
ttgaaaaaaatattactcgcgtgcagttcaggaatgtctaccagtttattggtgacaaaa
atgaaggaatacgcacagtctatcggtgaggaagcggagatttgggctgttggccaggat
aaagcaaaagaagacatgagaaaagcggatgccgttttgatcggtccgcaaatgagcttt
ctgaaaagcgagctccaaaaagaagcagatcaatacaacattcaagttgaagtcattgac
atgatggcctacggaatggcagatgggaaaaaagcgtatgagcaggcattgtccttaatg
gtgaatcaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU05820
Entry
BSU05820          CDS       T00010                                 

Symbol
gmuA
Name
(RefSeq) PTS system-oligo-beta-mannoside-specific transporter subunit IIA
  KO
K02759  cellobiose PTS system EIIA component [EC:2.7.1.196 2.7.1.205]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU05820 (gmuA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU05820 (gmuA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU05820 (gmuA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     BSU05820 (gmuA)
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     BSU05820 (gmuA)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU05820 (gmuA)
SSDB
Motif
Pfam: PTS_IIA DUF1771 Tab2_like
Other DBs
NCBI-GeneID: 938039
NCBI-ProteinID: NP_388463
Pasteur: BG12191
BSORF: BG12191
UniProt: O05506 A0A6M3Z7X1
Position
626933..627265
AA seq 110 aa
MEQMKITNLTDEQISFQLILHSGNARSCIIQSLRAYKEGKKDEADALIAKAEQDLSAAHD
IHFQMIQKESGGEATAFSLLLMHAEDHLMSTLSMKELVKEMLDLFKTKNI
NT seq 333 nt   +upstreamnt  +downstreamnt
atggaacagatgaaaatcacgaatttaacagacgagcaaatcagttttcagctaatcctg
cacagcggaaatgcccgcagctgcatcatacaatcactgcgcgcctataaagaagggaaa
aaggacgaggctgatgccctcattgccaaggcggagcaggatttatccgcggcccatgac
attcactttcaaatgatacagaaggaatccggcggagaagcaacagctttttcattgctg
cttatgcatgcagaggatcatctgatgtcaacattatccatgaaagaattagtgaaagag
atgcttgatctctttaaaaccaagaatatataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU05830
Entry
BSU05830          CDS       T00010                                 

Symbol
gmuC
Name
(RefSeq) PTS system-oligo-beta-mannoside-specific transporter subunit IIC
  KO
K02761  cellobiose PTS system EIIC component
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU05830 (gmuC)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU05830 (gmuC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU05830 (gmuC)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU05830 (gmuC)
SSDB
Motif
Pfam: PTS_EIIC
Other DBs
NCBI-GeneID: 939882
NCBI-ProteinID: NP_388464
Pasteur: BG12192
BSORF: BG12192
UniProt: O05507 A0A6M4JJ13
Position
627284..628612
AA seq 442 aa
MFEKISQFLVPIAGRLNNNRYLQVLRDAFMLAFPLTIFGSIFVVLTNLPFLNKIMNASML
TSFQSHFGIASTATMGIMSVFVVFGIGYYLSKSYQVEAVFGGAIALVSFLLLTPFIIQPE
TGDAITGVIPVDRLGAKGMFLGMITAFLSGEIYRRIVQKNLTIKMPAGVPPAVAKSFAAL
IPAFITLTVFLLINVMVTLFFKTNMHDVIYHAIQAPLVGLGSGIIPTLIAVFFIQILWFF
GLHGQIIINSVMDPIWNTLQVENLSAYTAGKEIPHIISKPFMEIYTVGMGGTGMTLAIVF
TILIFMKSRQMKQVSKLGLAPGIFNVNEPIIFGLPIVMNPIIIVPWVLAPMVVTLVTYLA
MSAGLVPPPTGVTVPWTVPLFINGIMATNSIMGGVMQLINLLIVFVIWFPFLKAMDKLNL
AKEKEQAVQETAAQQNDNSIKM
NT seq 1329 nt   +upstreamnt  +downstreamnt
gtgttcgagaaaatcagccaattccttgttccaattgcagggaggttaaacaataaccgc
tatttgcaagtgttgcgtgatgcatttatgctggctttcccgctgacgatattcgggtcc
atttttgtcgtgttaacgaatttgccgtttctaaacaaaatcatgaacgcctcaatgctt
acgtcgtttcagtctcatttcggcattgcctccacggcgacaatgggcattatgtctgtc
tttgttgtgttcgggataggctattacctgtcgaaaagctatcaggtcgaagctgtattt
ggcggagcgatcgctttggtttcctttttgctcttaacgccatttatcattcagccggaa
acaggtgatgccattacaggggttatcccggtcgatcgtctcggtgcaaaagggatgttt
cttgggatgattacggcatttctttctggcgaaatttacagaagaatcgttcaaaaaaac
ctgacaatcaaaatgccagccggcgttccgcctgctgtagcaaaatcattcgccgcactt
attccggcttttatcacattgactgtatttttgctgattaacgtaatggtgactctgttt
tttaaaacaaatatgcacgacgtcatttatcatgcgattcaggctccgcttgtcggactt
ggaagcggtatcattccaacactgattgccgtgtttttcattcaaattctttggtttttc
ggactgcatggacagatcattatcaactccgtgatggacccgatttggaatacactgcag
gtagaaaacctttctgcttacacggcgggaaaagaaatccctcatattatttcaaaaccg
tttatggagatttatacagtagggatgggcggaacagggatgacgcttgcgattgtgttt
accattctcatattcatgaaaagcaggcagatgaagcaagtatcaaaacttggcctcgct
cccggtatttttaacgtaaacgaaccgattatctttgggcttccgattgtcatgaatccg
atcattattgtgccttgggtgctggcaccgatggttgttacgctcgtcacctatctggct
atgtcagccgggctcgttccgcctccaactggtgtgacagtgccgtggacggttccatta
ttcattaatggcatcatggcgacgaactcaatcatggggggcgtgatgcagcttatcaat
ctgctgattgtcttcgtgatctggtttccgttcctaaaagcaatggataaattaaatctg
gcaaaagaaaaagaacaggctgtgcaggagacagctgctcagcaaaatgataacagcata
aaaatgtga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU38390
Entry
BSU38390          CDS       T00010                                 

Symbol
ywbA
Name
(RefSeq) permease IIC component YwbA
  KO
K02761  cellobiose PTS system EIIC component
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU38390 (ywbA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU38390 (ywbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38390 (ywbA)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU38390 (ywbA)
SSDB
Motif
Pfam: PTS_EIIC
Other DBs
NCBI-GeneID: 937331
NCBI-ProteinID: NP_391718
Pasteur: BG10562
BSORF: BG10562
UniProt: P39584 A0A6M3ZLM0
Position
complement(3938307..3939641)
AA seq 444 aa
MSTFTRVMEEKIMPVAGKIAGQRHLSALRDGIILTMPLIIIGSVFLILTSLPIPGYADFM
ASVFGNEWADKLGYPVNASFDIMAMIAAFGIAYRLAESYGVDALSAGAISIAAFLLATPF
EVPFTPHGSTESIMVGGGIPITLLGSKGLFVAMLIALFSTEIYRYIIQKNIVFKMPDGVP
PAVSKSFVALIPGFIIVLLVWLARLLIEMTPFQSLHNVVGDLLGTPLSILGGSLGGSLIA
EFVQMLLWSCGIHGASIIGGIMAPIWYGAMDANRLAFQAGEALPSIFTTQFFQIWINVGG
SGATLALVLTMLVRSRSKQMKQLGRLGIGPALFNINEPIIFGMPIVMNPLLIVPFIIAPL
LTITATYIGMSTGLVARPAGIAVPWTMPPLISGYLATGGKVSGAVMQLVNLLITCAIYYP
FFRIWDHQKWREESAVESGDKNVM
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgagcacattcactcgggtgatggaggaaaaaataatgcctgtcgccgggaaaattgcc
gggcagcggcatctcagcgctttgcgtgacggaattatcctgaccatgccgctgattatt
atcgggtctgtcttcttgattttaacgagcttgccgattccggggtatgctgatttcatg
gcgagtgtgtttgggaacgagtgggccgataagctcggatatcctgttaacgcttcgttt
gatattatggcgatgattgccgcttttgggatcgcctatcggctggcagaaagctatggt
gtcgatgccctttctgccggagcgatttcaattgccgcatttctgctggcaacaccgttt
gaggtgccgtttacaccgcatggctcaacggagtccatcatggtagggggcggaatcccg
atcacgctgctcggcagcaagggcttatttgtcgccatgctgatcgccttgttttcaacc
gaaatctatcggtacattattcaaaaaaatatcgtcttcaaaatgccagacggtgtgccg
cctgcggtaagcaaatcatttgtcgcgctgattcccggctttatcattgtgcttctcgta
tggctggcgcgtcttctgattgaaatgacaccttttcagagtctgcacaatgtcgtagga
gacctgcttggcacaccgctttccatccttggcggcagtctcggcggaagcctgatcgct
gaatttgtgcagatgctgctttggtcgtgcgggattcacggggcttccatcattggcgga
atcatggcgccgatttggtacggcgcgatggatgccaaccgtctcgccttccaagcaggc
gaggcgctgccgagtatttttacgactcagttttttcaaatttggatcaatgtcggcgga
agcggggcgacgctggcgcttgtcctgacgatgcttgtgcgctcccgcagcaaacaaatg
aagcagcttggacgattaggaatcggccctgcgctatttaatatcaacgagccgatcatt
ttcggcatgccgattgtcatgaatcccctccttattgtcccatttatcatcgcaccgctc
ctcacgattaccgcgacttatatcggcatgagcaccgggctggtggcaagaccggccgga
atcgcggtgccatggacgatgccgccgctcatatcaggttacctggcgacaggcggaaag
gtgtcgggcgcagttatgcagctggtaaatctgctgatcacctgtgctatctactatccg
tttttcagaatatgggatcatcaaaaatggcgggaagagagtgcggttgaatctggggat
aaaaatgtgatgtga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU38570
Entry
BSU38570          CDS       T00010                                 

Symbol
licA
Name
(RefSeq) PTS system-lichenan-specific transporter subunit IIA
  KO
K02759  cellobiose PTS system EIIA component [EC:2.7.1.196 2.7.1.205]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU38570 (licA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU38570 (licA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38570 (licA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     BSU38570 (licA)
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     BSU38570 (licA)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU38570 (licA)
SSDB
Motif
Pfam: PTS_IIA MAS20 YfdX Adeno_terminal HemY_N NikR_C
Other DBs
NCBI-GeneID: 937374
NCBI-ProteinID: NP_391736
Pasteur: BG11349
BSORF: BG11349
UniProt: P46319 A0A6M4JQJ7
Position
complement(3959841..3960173)
AA seq 110 aa
MNEEMEQIIFQIILHGGNGRSSAMEAIAAAKSGDAEEARKKLQDAAEELSKAHHYQTELI
QNEAGGEKTEMTLLMVHAQDHLMNAMTVKDMAAEIIELYEKITEQRGASI
NT seq 333 nt   +upstreamnt  +downstreamnt
gtgaatgaggaaatggaacaaatcatttttcaaatcatccttcacggaggaaacggtagg
agctccgcaatggaggccattgccgctgcgaaaagcggtgacgcagaagaagcgcggaaa
aagcttcaagacgctgctgaagaattgtcaaaagcccatcattatcagacagagctgatc
caaaatgaagcgggcggagaaaagacggaaatgacgcttctgatggttcatgcacaggat
catttaatgaatgcaatgacagtgaaggatatggctgcagagatcattgagttatatgaa
aaaatcaccgagcaaaggggagcaagcatatga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU38580
Entry
BSU38580          CDS       T00010                                 

Symbol
licC
Name
(RefSeq) PTS system-lichenan-specific transporter subunit IIC
  KO
K02761  cellobiose PTS system EIIC component
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU38580 (licC)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU38580 (licC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38580 (licC)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU38580 (licC)
SSDB
Motif
Pfam: PTS_EIIC
Other DBs
NCBI-GeneID: 937375
NCBI-ProteinID: NP_391737
Pasteur: BG11348
BSORF: BG11348
UniProt: P46317 A0A6M4JQK6
Position
complement(3960192..3961550)
AA seq 452 aa
MNKVNQILEEKVMPIAGRIAGQRHLQALRDGIILTMPLIIIGSFFLIIGNLPIPGYAEFM
AKTFGSSWSEKLAYPVDATFEIMGLVAAFGIAYRLAEKYGVDALSAGAISLAAFLLATPY
QVPFMPDGATKEIMVGGGIPLSLMGSKGLFVAMIIAMVSTEIYRLIIQRNLVFKMPDGVP
PAVSKSFVALIPGFAVIFLIWAARLIVEATPFESLHNIVSVLLGTPLSILGGSLGGSLVA
EAVKMLLWACGLHGANIVGGVMAPIWYGAMDANRIAFQAGEELPKIFTQQFFDIWVNIGG
SGATLALVVTMFLRARSKQMKQLGKLAVGPAIFNINEPIIFGMPIVMNPMLLLPFIITPL
VTVTLTYIGMSTGLVAKPAGIAVPWTMPPIFSGYLATGGKVSGAVMQAINIAVSFVVYYP
FFRMWDKQKLKEENDLELVQTPAATDDKEAAL
NT seq 1359 nt   +upstreamnt  +downstreamnt
gtgaataaagtcaatcagatcttagaagaaaaggtcatgcctatagcgggaagaattgcg
ggacagcgtcatttgcaggcgctgcgtgatggtatcatcctcacgatgcccctgattatc
atcggttcctttttcctcatcattggcaacctcccgatcccgggatacgctgagtttatg
gcaaaaacgtttggcagctcctggtctgaaaaactggcctacccagtcgacgcgaccttt
gaaattatgggtcttgtcgccgcgttcggcattgcctaccggctcgccgagaaatacggt
gttgatgccttgtcggccggagccatttcccttgcggcatttttattagcaacaccttat
caagtgccgtttatgccggatggcgcgacgaaagaaatcatggttggcggcgggattccg
ctttcgctcatgggaagcaaaggcttatttgtcgccatgattatcgcaatggtgtccaca
gagatttaccgccttattatccagcgcaatttagtcttcaaaatgccggacggtgtcccg
ccggcggtaagcaagtcatttgtcgcgttaatccccggctttgccgtcatcttcctaatt
tgggcagcccggctgattgttgaagcgacaccgtttgaaagccttcataatattgtaagc
gttttattggggactccgctttccattctgggaggaagccttggaggaagccttgtcgcc
gaagccgtcaaaatgcttttatgggcctgcggccttcacggtgcaaacattgttggcggc
gtcatggcaccgatttggtacggcgcaatggatgccaaccggatcgcattccaagccggt
gaggagcttcctaagattttcacccagcaatttttcgatatctgggtcaatattggcgga
agcggcgccacattggcactggttgtcacgatgttcctgcgcgcccgaagcaaacaaatg
aagcagctcgggaagcttgcggtcggcccggccatcttcaatattaacgaaccgattata
ttcggaatgccgatcgtcatgaacccaatgctcttacttccgtttatcatcacgccgctt
gtcacagtgacactcacgtacatcggaatgagcaccggccttgtcgccaaaccggcgggt
atcgcagtgccgtggaccatgccgccgatcttttcaggctacttggcgacaggaggaaaa
gtctcaggcgcggtcatgcaagccattaatattgccgtgtcctttgttgtctactatcca
ttcttcagaatgtgggataagcagaagctgaaagaagaaaacgatctggagctggtccaa
acgcctgcagcaacagatgacaaagaagcggctctgtag

KEGG   Bacillus subtilis subsp. subtilis 168: BSU38590
Entry
BSU38590          CDS       T00010                                 

Symbol
licB
Name
(RefSeq) PTS system-lichenan-specific transporter subunit IIB
  KO
K02760  cellobiose PTS system EIIB component [EC:2.7.1.196 2.7.1.205]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU38590 (licB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU38590 (licB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38590 (licB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     BSU38590 (licB)
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     BSU38590 (licB)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU38590 (licB)
SSDB
Motif
Pfam: PTS_IIB
Other DBs
NCBI-GeneID: 937379
NCBI-ProteinID: NP_391738
Pasteur: BG11347
BSORF: BG11347
UniProt: P46318 A0A6M3ZIH7
Position
complement(3961566..3961874)
AA seq 102 aa
MNILLVCAAGMSTSLLVSKMEKSAQEQGKDYTIWAVSGDSVQNHIDKADVLLLGPQVRYM
LPQLKKLGESKGVPVDVINTVHYGTCNGAEVLKSAEQLGHVS
NT seq 309 nt   +upstreamnt  +downstreamnt
atgaatatattactcgtttgtgcagcaggcatgtctactagcttactggtgagcaagatg
gaaaaaagtgcgcaggaacagggaaaagactataccatttgggcagtttcaggcgattct
gtacaaaatcatatcgataaagcggatgtattgcttctcggtccgcaagtccgttacatg
cttccgcagctcaaaaaattaggagagtcaaagggggttccggtagacgtcattaatacc
gtccattatggaacgtgcaatggggcggaagtgctgaaatcagctgaacagcttggacat
gtgtcatag

DBGET integrated database retrieval system