KEGG   Bacillus subtilis subsp. subtilis 168: BSU05860
Entry
BSU05860          CDS       T00010                                 

Symbol
gmuE
Name
(RefSeq) fructokinase
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00051  Fructose and mannose metabolism
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU05860 (gmuE)
   00500 Starch and sucrose metabolism
    BSU05860 (gmuE)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU05860 (gmuE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     BSU05860 (gmuE)
SSDB
Motif
Pfam: ROK Phage_gp49_66
Other DBs
NCBI-GeneID: 938016
NCBI-ProteinID: NP_388467
Pasteur: BG12195
BSORF: BG12195
UniProt: O05510 A0A6M4JFH3
Structure
PDB: 
3OHR 1XC3 3LM9

Position
630912..631811
AA seq 299 aa
MLGGIEAGGTKFVCAVGREDGTIIDRIEFPTKMPDETIEKVIQYFSQFSLQAIGIGSFGP
VDNDKTSQTYGTITATPKAGWRHYPFLQTVKNEMKIPVGFSTDVNAAALGEFLFGEAKGL
DSCLYITIGTGIGAGAIVEGRLLQGLSHPEMGHIYIRRHPDDVYQGKCPYHGDCFEGLAS
GPAIEARWGKKAADLSDIAQVWELEGYYIAQALAQYILILAPKKIILGGGVMQQKQVFSY
IYQYVPKIMNSYLDFSELSDDISDYIVPPRLGSNAGIIGTLVLAHQALQAEAASGEVRS
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcttggcggtattgaagcaggcggcacaaagtttgtttgtgctgtcggtagagaagat
ggaacgatcattgacaggatagaattccccacaaagatgccggatgaaacgatagagaaa
gtaattcaatattttagccaattttcattacaggcaatcggcatcggctcctttggtccc
gttgataacgataaaaccagtcaaacatacggtaccattacggccacgccgaaagcgggc
tggagacactatccctttttgcaaaccgttaagaacgaaatgaagatcccagtcggattt
agtacagatgtcaacgctgcggcgctgggtgaattccttttcggtgaagcgaagggtctt
gacagctgcctgtatataacgattggcactggcatcggagcgggggctattgtagagggg
aggctccttcaggggctgtcacacccagagatgggccatatttatatccggaggcacccg
gatgacgtataccaagggaagtgcccttatcatggagattgctttgaaggcttagcttca
ggccccgctatcgaagcccgctgggggaaaaaagccgcggatttatcagatatagcacaa
gtctgggaactggaagggtactatattgcccaagcactggctcagtatattttgatcctt
gcacctaaaaaaatcattcttggcggcggcgtcatgcaacagaaacaagtgttttcttat
atctatcaatatgtaccaaaaatcatgaacagctacttagatttttctgaattatcagat
gatataagtgattatattgtacctccacgtttaggcagtaacgccggaatcatcggcacg
ctagttttagcgcatcaggccttacaagcagaggcagcatccggggaggtgcgatcatga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU06170
Entry
BSU06170          CDS       T00010                                 

Symbol
ydjE
Name
(RefSeq) sugar kinase YdjE
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00051  Fructose and mannose metabolism
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU06170 (ydjE)
   00500 Starch and sucrose metabolism
    BSU06170 (ydjE)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU06170 (ydjE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     BSU06170 (ydjE)
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-GeneID: 939494
NCBI-ProteinID: NP_388498
Pasteur: BG12796
BSORF: BG12796
UniProt: O34768 A0A6M4JDM0
Position
670087..671049
AA seq 320 aa
MRSHSVVCIGELLIDFFCTDVDVDLMEGRQFLKSAGGAPANVSAAIAKLGGDAAFSGKVG
KDPFGYFLKRTLDAVHVDTSMLVMDEKAPTTLAFVSLKQNGERDFVFNRGADALFTLEDI
DQEKLNEAKILHFGSATALLSDPFCSAYLRLMSIAKDNGQFISFDPNYREDLWRGRVSEF
VSVAKKAIAVSDFVKVSDEELEIISGVKDHEKGVAILHEIGANIVAVTLGKSGTLLSNGK
DREIIPSIPVTSIDSTGAGDAFVGAALYQLANTDQIQSVDADFVKLREIVAFANKVGALV
CTKIGAIDALPSLDEIGVSL
NT seq 963 nt   +upstreamnt  +downstreamnt
atgcgtagtcattctgtagtttgtattggggaattgttgattgatttcttttgtaccgat
gttgacgttgatttaatggaagggcgccaattcctgaaaagtgccggcggggcaccggcg
aatgtgtcggcagcgattgccaagctgggcggagacgccgctttcagcggaaaagtagga
aaggatccgtttgggtattttctgaagcgaacattggacgctgtacatgtcgatacctct
atgctggtgatggatgagaaagcgcctacaacgcttgcttttgtttcattaaaacaaaat
ggagagcgtgactttgtttttaatagaggcgcggacgctttgtttacgctggaggacatt
gaccaggaaaaactaaacgaagcgaaaatccttcatttcggctctgcgacggcactgtta
tcggatccgttttgctcagcctatttacggttgatgtcgattgcgaaagacaatggacag
tttatttcgtttgaccctaactaccgtgaagatttatggaggggaagagtctcagagttt
gtaagtgttgcgaaaaaagcgatcgctgtaagtgattttgtgaaagtcagtgacgaggaa
cttgagattatcagcggtgtgaaggatcatgaaaagggagttgcgatccttcatgagatc
ggagccaacattgtcgctgtgacacttgggaaaagcggaacgcttctttccaatggaaaa
gaccgtgaaatcattccaagcattccggtgacatcaattgactcaacaggggcgggagat
gcttttgtcggtgcggctttatatcaattggcaaacacggatcagattcaatctgtagat
gctgattttgtgaaactgcgtgagattgtggcgtttgccaataaggtcggagctcttgtg
tgcactaaaattggagcgattgatgcactgccgagtttggatgagattggagtttctttg
taa

DBGET integrated database retrieval system