KEGG   Bacillus subtilis subsp. subtilis 168: BSU05900
Entry
BSU05900          CDS       T00010                                 

Symbol
thiL
Name
(RefSeq) thiamine-monophosphate kinase
  KO
K00946  thiamine-monophosphate kinase [EC:2.7.4.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00895  Thiamine biosynthesis, prokaryotes, AIR (+ DXP/glycine) => TMP/TPP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU05900 (thiL)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.16  thiamine-phosphate kinase
     BSU05900 (thiL)
SSDB
Motif
Pfam: AIRS AIRS_C Glyco_hydro_2_N
Other DBs
NCBI-GeneID: 939867
NCBI-ProteinID: NP_388471
Pasteur: BG10693
BSORF: BG10693
UniProt: O05514 A0A6M3Z7W4
Position
640662..641639
AA seq 325 aa
MDEFDLIHSITPRTIHHSSVDVGIGDDAALYTAKHGVQEIVCVDTMVEDVHFKLHYSSPE
DIGYKALAVNISDIAAMGGIPKFYLVSLAVPSKWTESEIKAMYEGMNELAKLYHMDLIGG
DTVSTADKLVVTVTVIGEIEKGQACLRSLAKPNDIVFVTGEIGSSAAGLSLLLEETNPQN
SSVETDYFIHRHKRPEPRVSVGRLCSIFKRAALNDVSDGLASELNEIAEASCVSIEIVES
MLPIHSDLPKLHPNWKEWALFGGEDFELTGTVSNEEWEVLKQECAALHLPITKIGYVREK
TKSKVILKTDQTSMILEKKGYNHFK
NT seq 978 nt   +upstreamnt  +downstreamnt
atggatgaatttgatttgatacatagcattactccgcggaccattcaccattcttccgtt
gatgtaggaataggtgatgatgcagcgctctacactgcgaaacacggcgttcaggaaatt
gtttgtgttgatactatggtagaagacgtgcacttcaaattacactattcctcacctgaa
gatatcgggtacaaggcgttagccgttaatataagtgatattgccgcgatgggaggcatt
cctaagttttatctggtatcacttgcggtaccttcaaaatggactgaatctgaaatcaag
gcgatgtatgaaggaatgaatgaactggcgaaactatatcatatggatctgattggcggc
gatacagtttctaccgctgacaaattagtcgttacagtcactgtaatcggtgaaattgaa
aagggacaggcctgtttgcgcagcttggcaaaaccgaatgatattgtgtttgtaaccggt
gaaatcggttcttctgcagcagggctttctttattgctggaagagactaatcctcaaaac
tcatctgtggaaacggattactttatccacaggcataaacggcctgagccaagagtaagc
gtcggcagattatgctcgatttttaaacgggcagctttaaatgatgttagtgacggattg
gctagtgaactgaacgagattgcagaagccagctgtgtttcaattgaaattgttgaaagc
atgcttccaattcattctgatttgcctaagcttcatcctaactggaaagaatgggctttg
tttggcggtgaggattttgagctgacagggacggtttcaaatgaggagtgggaagtgttg
aagcaggagtgcgcagcgcttcatcttcccattacaaagattggctatgtcagggaaaaa
acaaaatctaaagtgatcctaaaaacagatcaaacatcaatgatcttagagaaaaaggga
tataatcattttaaataa

DBGET integrated database retrieval system