KEGG   Bacillus subtilis subsp. subtilis 168: BSU06430
Entry
BSU06430          CDS       T00010                                 

Gene name
purK
Definition
(RefSeq) 5-(carboxyamino)imidazole ribonucleotide synthase
  KO
K01589  5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06430 (purK)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     BSU06430 (purK)
SSDB
Motif
Pfam: ATP-grasp PurK_C Dala_Dala_lig_C 2-Hacid_dh_C NAD_binding_2 Pyr_redox 3HCDH_N XdhC_C AlaDh_PNT_C HI0933_like NAD_binding_7
Other DBs
NCBI-GeneID: 936039
NCBI-ProteinID: NP_388525
Pasteur: BG10701
BSORF: BG10701
UniProt: P12045 A0A6M3Z831
Position
699093..700235
AA seq 380 aa
MSKQIIYPGAVIGIIGGGQLGKMMAVSAKQMGYKVAVVDPVKDSPCGQVADVEITAHYND
REAIRKLAEISDIITYEFENIDYDALHWLKDHAYLPQGSELLLITQNRETEKKAIQSAGC
EVAPYSIVKTKNELKQAVQELRLPAVLKTCRGGYDGKGQFVIKEEAQMEQAAALLEHGTC
ILESWVSFKMELSVIVVRSVNGEISTFPTAENIHHNNILFQSIVPARVEKGIQQKAADLA
VKLADELNLVGPLAVEMFLTEDGELLVNELAPRPHNSGHYTLDLCETSQFEQHIRAVCGL
PLGKTDLLKPGMMVNLLGDEVKLVEEDPELLKEAKLYIYGKHEIKKGRKMGHITFMKQPE
DEWIQEITNKWMNRDGGQAE
NT seq 1143 nt   +upstreamnt  +downstreamnt
ttgtctaaacaaatcatctatccgggagctgtaatcggcattatcggcggcggccagctt
gggaaaatgatggctgtgtccgccaaacaaatggggtataaagtcgcggtcgttgatccg
gtgaaagattcgccgtgcgggcaggttgcggatgtcgaaattaccgctcattataatgac
cgtgaagcgattcgaaaattggctgaaatcagcgatatcatcacatatgagtttgaaaac
atcgactatgatgcgctgcattggctaaaagatcatgcgtatctcccgcaaggaagtgag
ctgctgcttattacccaaaaccgtgaaacagagaaaaaagcaattcaatccgcgggctgt
gaagtcgcaccgtacagcatcgtcaaaacaaagaatgaattgaaacaggcagtacaggag
ctcaggcttccggcagtgctgaaaacatgccgcggcgggtacgacggcaaaggccaattt
gtgataaaagaagaggcgcaaatggagcaggcagccgctctgttagaacacggaacttgc
attcttgaaagctgggtttcttttaaaatggaactgtcggtgatcgtcgttagatcggta
aacggtgaaatttcaacatttccgacagctgaaaacattcaccacaacaatattcttttc
caaagcatcgtgcccgcacgggtagagaaagggattcagcagaaggctgctgatctcgca
gttaagcttgcagatgagcttaaccttgtcggaccgcttgctgttgagatgttcctgaca
gaggacggagagcttttggtcaatgaactggcgccaagaccgcacaattcagggcattat
acgctggacctttgcgagacgagccagtttgagcagcatatcagagcggtatgcgggctt
ccgcttgggaagacagatttgctgaagccgggcatgatggtgaatcttctcggcgatgaa
gtgaagcttgttgaggaagacccggagcttttaaaagaggcaaagctatatatatacgga
aaacatgaaatcaaaaaaggccgcaaaatggggcatattacatttatgaagcagcctgaa
gacgaatggattcaggagatcacaaataaatggatgaatagagacggaggacaagcagaa
tga

DBGET integrated database retrieval system