KEGG   Bacillus subtilis subsp. subtilis 168: BSU06500
Entry
BSU06500          CDS       T00010                                 

Gene name
purM
Definition
(RefSeq) phosphoribosylformylglycinamidine cyclo-ligase
  KO
K01933  phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06500 (purM)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     BSU06500 (purM)
SSDB
Motif
Pfam: AIRS_C AIRS
Other DBs
NCBI-GeneID: 936044
NCBI-ProteinID: NP_388532
Pasteur: BG10708
BSORF: BG10708
UniProt: P12043 A0A6M3Z814
Position
706973..708013
AA seq 346 aa
MSEAYKNAGVDIEAGYEAVKRMKKHVERTKRLGVMGSLGGFGGMFDLSELSYQKPVLISG
TDGVGTKLKLAFSMDKHDTIGVDAVAMCVNDVLAQGAEPLFFLDYLAVGKADPVKIEQIV
QGVAEGCEQSGSALVGGETAEMPGLYTADEYDIAGFSVGVAEKDEIVTGEKIEEGHLLIG
LSSSGLHSNGFSLVRKVLLDDAELDLDTTYEPFERPLGEELLEPTRIYVKPVLAAVKSGK
IDGMAHVTGGGFIENIPRMLPEGLSAEIDHGSWPIPPIFSFLQEYGKLKEEDMFNVFNMG
IGFVLAVKEEHLTDVIGTLESHGEKAYLIGRVKKGEGVTFGGAALS
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgtctgaagcatataaaaacgcaggagttgacatcgaagccggatatgaagctgtaaaa
cgaatgaaaaaacacgtggagcgcacgaaacggcttggcgttatgggcagccttggcggt
tttggcggcatgtttgacctgtctgagctttcttatcaaaaaccagttctcatttcggga
acggacggtgtcggcacaaaattaaagctcgctttttccatggataagcatgacacgatt
ggcgtggatgctgttgcaatgtgtgtcaatgacgtgctggcacaaggtgcagagccgctg
tttttcctcgattatttagcggttggcaaagcggacccagtgaaaattgaacagattgta
caaggtgttgcggaaggctgtgagcagtcaggttcagccttagtcggcggtgaaacggct
gaaatgccggggctctatacagctgatgaatacgatattgccggtttctcagtcggagtg
gcagaaaaggacgaaatcgtgactggagaaaaaattgaagagggccatctgttgatcggc
ctcagctccagcggccttcacagcaacggcttttcccttgtcagaaaagtgcttctggat
gatgcggagctggacctcgatacaacatatgagccgtttgaacgcccgcttggcgaggaa
ttgcttgaaccgacaaggatttacgtgaagcctgtgcttgccgcggtcaaaagcggaaaa
atcgacggcatggcgcacgtgacaggcggaggatttattgaaaatattccgcgtatgctt
ccggaaggcttaagtgcggaaattgatcatggctcatggccgatcccgccgattttttct
ttcttgcaagagtacggcaagctaaaggaagaagacatgttcaacgtctttaatatgggt
atcggttttgttttggcagtcaaagaagagcatctgacagatgtgatcggaacgcttgaa
agccatggcgaaaaagcctatttaatcgggcgtgtgaaaaaaggtgaaggcgtcacattc
ggcggtgcggcactttcatga

DBGET integrated database retrieval system