KEGG   Bacillus subtilis subsp. subtilis 168: BSU06560
Entry
BSU06560          CDS       T00010                                 

Gene name
yerA
Definition
(RefSeq) adenine deaminase YerA
  KO
K01486  adenine deaminase [EC:3.5.4.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06560 (yerA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.2  adenine deaminase
     BSU06560 (yerA)
SSDB
Motif
Pfam: Adenine_deam_C Amidohydro_1 Amidohydro_3
Other DBs
NCBI-GeneID: 939337
NCBI-ProteinID: NP_388538
Pasteur: BG12829
BSORF: BG12829
UniProt: O34909 A0A6M3Z8R4
Position
713664..715406
AA seq 580 aa
MSERTFNWKNKDIRAQVDVVDSKLLPTLLLRNALVLNPYVKQWLKKNIWIYQDRIVYVGH
ELPNRAEEIHTIDCEGKYIVPGYIEPHAHPFQIYNPQTLAEYVSQYGTTTFVNDNLFLLL
QSGKKKALTILNELKKQPVQYFWWSRYDLQTEVLNEDHVLPFDVRKQWIEHPDVIQGGEM
TGWPRLVDGDDLMLHCMQATKKQRKRIEGHFPGASDKTLTKMKLFGADCDHEAMTGDEVM
RRLELGYYVSLRNSSIRPDVRKILQELHEKGFRYYDHFFYTTDGATPNFYKGGMTNELIR
IALEEGVPAIDAYNMASFNIAKYYQMDDYLGVVGPGRLASLNILEDPLNPNPVTVLSKGT
ILRENGCDLKAFTKTDWHKGGLVPLELSYDMTMDDLQFSMPMGVKMRNAVIMEPYMIEID
NSMEQLSFDHDESYLTMLDRHGKWRVNTMIKGFASSVQGFVSSFTTTGDIVAIGKNKADM
LLAFARMKEIGGGIVLAENGNILHEIPLALCGCASSEAYEDVLEKEQKLRDLLTERGYEF
CDPIYTLLFLQSTHLPYIRITPRGIFDVMKKTVLFPSIMR
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgtccgaacgcacctttaactggaaaaacaaagacatcagggcacaggttgatgttgta
gactcaaagctgcttccaacgctccttttacggaatgctctcgtcttaaatccatatgta
aaacaatggctgaaaaaaaacatttggatttatcaggaccgcattgtttatgtgggtcat
gaacttccgaatagagccgaagaaattcatacgattgattgtgaaggaaaatacattgtg
ccaggttatattgaaccgcacgcacatccttttcaaatatataatccccaaacactggcg
gaatatgtgtctcaatacggaacaacgacattcgtgaatgataacttatttttgcttttg
caaagcggaaaaaagaaagcgcttacgattttgaatgaactcaaaaagcagcctgtccag
tatttttggtggtcacgctatgacctccagaccgaggttctgaacgaggaccacgtcctt
ccatttgacgtcagaaaacagtggattgaacatccggatgtgattcaaggcggagaaatg
accggatggcctcgcctggtagatggtgatgatttaatgctccactgtatgcaagctaca
aagaaacagagaaaacgtattgaagggcattttcccggcgcttctgataaaacgcttaca
aaaatgaagctgttcggtgcggattgtgatcatgaagcgatgacaggtgatgaagtgatg
agaaggctggaactgggctattatgtttcccttcggaactcttccattcgccccgatgta
agaaaaatcttgcaagagctgcatgagaagggcttccgctattatgaccacttcttttac
acgacagatggcgcaaccccgaatttctataaaggcggcatgacaaacgagctgattcgc
attgcgttagaagaaggcgtacctgcaatcgacgcctacaatatggcatcatttaatatc
gcaaagtattaccaaatggatgattatttaggagttgtcggaccgggcagactggcatcg
ctaaacatactggaagatccgttaaatccgaatccagtgactgttctgtcaaaagggacc
attctgcgtgaaaacggctgtgatttgaaggcgtttacaaagacggactggcacaaaggc
ggtcttgtcccgcttgagctttcatatgatatgacgatggatgacttgcagttttctatg
ccgatgggcgtgaaaatgcggaatgcggttattatggagccatatatgattgagatcgac
aattcgatggaacagctctcgtttgaccatgatgaaagttatttgacgatgctcgacaga
cacgggaaatggcgcgtcaatacgatgataaaagggtttgcctcaagcgtgcagggattt
gtaagctcctttacgacgacgggcgacattgtcgcgattggaaaaaataaagcggatatg
ctgctcgctttcgcccgcatgaaagaaatcggaggaggaattgttttagcggagaacgga
aacattctgcatgaaatcccgcttgcgctgtgcggctgcgcctcttcggaagcgtatgaa
gacgtgcttgagaaggaacaaaagctgagagatcttttgactgaaagaggctatgagttt
tgcgatcctatctatacgctgctctttttgcaaagtacgcaccttccgtatatacgcatt
acgccaagaggaatattcgacgtcatgaaaaaaactgtactctttccatcgataatgcgt
taa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU14520
Entry
BSU14520          CDS       T00010                                 

Gene name
adeC
Definition
(RefSeq) adenine deaminase
  KO
K01486  adenine deaminase [EC:3.5.4.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU14520 (adeC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.2  adenine deaminase
     BSU14520 (adeC)
SSDB
Motif
Pfam: Adenine_deam_C Amidohydro_1 Amidohydro_3 Urease_alpha
Other DBs
NCBI-GeneID: 939477
NCBI-ProteinID: NP_389335
Pasteur: BG11044
BSORF: BG11044
UniProt: P39761 A0A6M4JLE8
Position
1521351..1523084
AA seq 577 aa
MNKEALVNRLNASAKRQKADIVIKNGKIMDVYNQEWIYEDIAITDGVIVGLGEYEGENII
DAEGQMIVPGFIDGHVHIESSMVTPIEFAKAVLPHGVTTVVTDPHEIANVSGEKGIEFML
EQARHTPLNIHFMLPSSVPAASFERSGAILKAADLKPFYEEEEVLGLAEVMDYVSVQQAE
KDMVQKLLDARVAGKRIDGHLAGLSTDLINIYRTAFVLNDHEVTSKEEALDRIRRGMYVM
MREGSVAKNTLNVLPAVNEKNARRFFFCTDDKHVDDLLSEGSVNHQVKMAIQAGLNPFLA
YQLGSLNAAECYGLDTKGAIAPGFDADLLFVSDLENVTVTMTMVKGQTVAEDSKAVYQDH
ASTAAPDQALLDSVKLAAPLNKQDFHMPIDSEQQINVIQIIPNQLETRLVQVPAPVAREF
EPDTELDLLKIAVVERHKGLKETGLGVVKGFGFKSGAIATTISHDSHNIIAVGTNDEDIA
AAVNKLQEIGGGLTIIKNGEELHSVPLPIAGLLSDQSAEQVNQSLLTLHDKLSLIGFTGG
FNPFLTLSFLALPVIPDIKMTTTGLFDVKSFQHISLQ
NT seq 1734 nt   +upstreamnt  +downstreamnt
ttgaataaagaagcgctagtcaataggctgaatgcttcagccaaaagacaaaaagctgat
atcgtcattaaaaacggaaaaatcatggacgtatataatcaagaatggatatatgaagat
attgcgattacagatggagttattgtaggcctcggtgagtatgaaggcgaaaatatcatt
gatgcagagggacaaatgattgttccgggttttattgatggacatgtacatattgagtcg
tcaatggttacaccgattgagttcgctaaagcagtgttgcctcatggcgtgacgacggtt
gttacagatccgcatgagatcgcgaatgtgtctggtgaaaaagggattgagtttatgctt
gaacaagctcggcatacaccgctgaatatccattttatgcttccttccagtgtgcctgcc
gcaagttttgagcgatcaggcgcaattctcaaagctgccgatctcaagcctttttatgaa
gaagaagaagtattagggctggctgaagttatggattatgtgtcggttcagcaggctgaa
aaagacatggttcagaaactgcttgatgcccgtgtggcaggaaaaaggatagacggtcat
ttagctggtttatcaacagacctcattaacatttacagaaccgcatttgtcttaaacgac
catgaagtaacatcgaaggaagaagcccttgatcgtatcagaaggggcatgtatgtcatg
atgcgtgaaggatcagtcgccaaaaacacgctcaatgtgctgccggcggtgaatgaaaag
aacgcacgccggttctttttctgtacggatgataagcatgtggatgatttattgtcagag
ggaagtgtaaaccatcaggtgaaaatggcgattcaagccggacttaatccgtttttagcc
tatcagctaggaagcctcaatgcagccgaatgctacggattagatacaaagggagcgatt
gccccgggttttgacgctgatttgctttttgtatctgatctggaaaatgtcactgtcaca
atgacgatggtaaaagggcagactgttgctgaagacagcaaagcggtctatcaggatcat
gcttcaactgcagcaccagatcaggcactgcttgattctgttaagcttgctgctcctctt
aacaaacaggattttcatatgccaatcgattcagagcagcagatcaatgtcattcaaatc
ataccaaatcagcttgaaacacgattagtacaagttccggctcctgttgcccgcgaattt
gagcctgacactgagcttgatttgttaaagattgcagttgtcgagcggcataaaggatta
aaagaaaccggacttggtgttgtgaaaggttttggattcaagagcggagcgattgccaca
accatttcacacgactcccataatattattgccgtcggaacgaatgatgaggatatcgcg
gcggcagttaataagctgcaggaaattggcggaggattaacaattataaaaaatggggaa
gagctccattcagtaccgctgccgattgcagggttattatccgaccaatctgcagagcaa
gtgaatcaaagcttgctgacgcttcatgataaattgtcgttaatcggtttcacaggcgga
tttaatccatttttgacattgtcgtttttagcgttgcctgtcattcctgatattaaaatg
acgactacgggattattcgatgtaaaatcatttcaacacatatcactgcaataa

DBGET integrated database retrieval system