KEGG   Bacillus subtilis subsp. subtilis 168: BSU06830
Entry
BSU06830          CDS       T00010                                 

Symbol
rapH
Name
(RefSeq) response regulator aspartate phosphatase H
  KO
K06366  response regulator aspartate phosphatase H [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU06830 (rapH)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU06830 (rapH)
SSDB
Motif
Pfam: RapH_N TPR_2 TPR_12 TPR_7 TPR_1 TPR_10 TPR_8 TPR_16 DUF627 Foie-gras_1
Other DBs
NCBI-GeneID: 936065
NCBI-ProteinID: NP_388565
Pasteur: BG11031
BSORF: BG11031
UniProt: Q59HN8 A0A6M4JKW0
Structure
PDB: 
3Q15

Position
750959..752089
AA seq 376 aa
MSQAIPSSRVGVKINEWYKMIRQFSVPDAEILKAEVEQDIQQMEEDQDLLIYYSLMCFRH
QLMLDYLEPGKTYGNRPTVTELLETIETPQKKLTGLLKYYSLFFRGMYEFDQKEYVEAIG
YYREAEKELPFVSDDIEKAEFHFKVAEAYYHMKQTHVSMYHILQALDIYQNHPLYSIRTI
QSLFVIAGNYDDFKHYDKALPHLEAALELAMDIQNDRFIAISLLNIANSYDRSGDDQMAV
EHFQKAAKVSREKVPDLLPKVLFGLSWTLCKAGQTQKAFQFIEEGLDHITARSHKFYKEL
FLFLQAVYKETVDERKIHDLLSYFEKKNLHAYIEACARSAAAVFESSCHFEQAAAFYRKV
LKAQEDILKGECLYAY
NT seq 1131 nt   +upstreamnt  +downstreamnt
ttgagtcaagccataccgtcttcgcgtgttggtgttaagattaatgaatggtataaaatg
attcgccagttcagtgttccggatgctgagattctgaaagcggaggttgagcaggacatt
cagcagatggaagaagatcaggatttactgatctattattctctgatgtgttttcggcac
cagctgatgcttgattatttggagccgggaaaaacatacgggaatcgccctacagtgaca
gagcttcttgaaacgatcgagacccctcagaaaaaactcacaggtcttttgaaatactac
tctttgtttttccgcggcatgtatgaatttgaccaaaaagaatatgtggaagcgatcgga
tattatcgcgaggcggagaaagaactgccgtttgtgtcagatgatattgagaaagcggaa
ttccattttaaagtggcagaagcgtattatcacatgaagcaaacccatgtgtcgatgtat
catattcttcaagccttggacatttatcaaaaccatcctctatacagcattagaacgata
caaagcttgtttgtgatcgccggcaactatgatgatttcaaacattatgataaagcgctc
ccgcatttagaggcggcgctggaattggcaatggacattcaaaatgacaggtttatcgcc
atttctctattgaacattgcaaacagctatgacagatcaggagacgatcagatggctgta
gaacatttccaaaaagcggcgaaagtaagcagagagaaagtgcctgatctgcttccgaaa
gtcttgtttggattaagctggacattatgtaaagcgggccaaacacagaaggcgtttcag
ttcatagaggaaggattagaccatatcacagcacgttctcacaaattttataaagaattg
tttctgttcttgcaggccgtgtacaaggagactgttgatgaacgaaaaattcatgatctt
ttaagctatttcgaaaaaaagaacctgcacgcttacattgaagcatgtgcccggagtgct
gccgctgtttttgaaagcagctgtcactttgaacaagcagctgcgttttatcggaaagtg
ctgaaagcccaagaagatattctaaaaggagagtgtttatatgcctattaa

DBGET integrated database retrieval system