KEGG   Bacillus subtilis subsp. subtilis 168: BSU07270
Entry
BSU07270          CDS       T00010                                 

Symbol
yfnH
Name
(RefSeq) glucose-1-phosphate cytidylyltransferase
  KO
K00978  glucose-1-phosphate cytidylyltransferase [EC:2.7.7.33]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00541  O-Antigen nucleotide sugar biosynthesis
bsu01100  Metabolic pathways
bsu01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU07270 (yfnH)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU07270 (yfnH)
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BSU07270 (yfnH)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.33  glucose-1-phosphate cytidylyltransferase
     BSU07270 (yfnH)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 IspD DPM2
Other DBs
NCBI-GeneID: 938779
NCBI-ProteinID: NP_388608
Pasteur: BG12979
BSORF: BG12979
UniProt: O06486 A0A6M4JDX2
Position
798469..799233
AA seq 254 aa
MKAVILCGGKGTRMSEVTNDIPKPLAMIGGKPILWHIMKIYQYYGVNEFILLLGYKGEKI
KEYFLDYEWKHNSLTLDSSTGEVQMLGQPETWKITFLETGVDTLTAGRILQAKDYIGDET
FLLTYGDGLANINLFHLISYHQTKGAAATVTGIDKVSQFGTLTVEDGMAKTFSEKTSSDG
IINGGFFVLSPKVFDYLPKDGNTMFEDEPLKNLAKDGELAVYRHYGFWTAIDTYKNLLEV
NKMWNQGQQVWKVW
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaaagcggtcattctctgcggcggaaaaggaacgagaatgagtgaagtcacgaatgac
attcctaaaccgctcgccatgataggcggcaaaccgattctatggcatattatgaaaatt
tatcagtactacggagtaaacgagtttattctgcttttgggctataaaggagaaaaaatc
aaggaatactttctcgactatgaatggaagcacaacagcctgacactcgacagctctacg
ggagaggtacagatgctggggcagcctgaaacgtggaaaattacgtttttggagactggg
gtagatacgctgacagccggaagaatcttgcaggcgaaagactatatcggtgatgaaaca
tttctgctcacctatggagacgggctggccaatatcaatcttttccatctcatcagctat
catcagacaaaaggtgctgccgcgactgtcaccggcattgacaaagtctcgcagtttggc
accttgacagttgaggatggcatggcgaaaacattttctgagaagacatcaagtgatgga
atcatcaacggcggattcttcgttcttagtccaaaggttttcgattatttgccgaaggac
gggaacacgatgttcgaagatgaaccgctgaagaaccttgccaaagatggggagcttgct
gtgtaccgccattacggattttggacggccatcgatacgtataaaaatctcttagaagtc
aacaaaatgtggaatcaaggacaacaagtatggaaggtatggtga

DBGET integrated database retrieval system