KEGG   Bacillus subtilis subsp. subtilis 168: BSU07810
Entry
BSU07810          CDS       T00010                                 

Symbol
treA
Name
(RefSeq) trehalose-6-phosphate hydrolase
  KO
K01226  trehalose-6-phosphate hydrolase [EC:3.2.1.93]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU07810 (treA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.93  alpha,alpha-phosphotrehalase
     BSU07810 (treA)
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase Alpha-amylase_C Glyco_hydro_42C DUF3459 DKNYY
Other DBs
NCBI-GeneID: 939690
NCBI-ProteinID: NP_388662
Pasteur: BG11010
BSORF: BG11010
UniProt: P39795 A0A6M3Z8J1
Position
851850..853535
AA seq 561 aa
MKTEQTPWWKKAVVYQIYPKSFNDTTGNGVGDLNGIIEKLDYLKTLQVDVLWLTPIYDSP
QHDNGYDIRDYYSIYPEYGTMEDFERLVSEAHKRDLKVVMDLVVNHTSTEHKWFREAISS
IDSPYRDFYIWKKPQENGSVPTNWESKFGGSAWELDEASGQYYLHLFDVTQADLNWENEE
VRKHVYDMMHFWFEKGIDGFRLDVINLISKDQRFPNAEEGDGRSFYTDGPRVHEFLHEMN
EKVFSHYDSMTVGEMSSTTVDHCIRYTNPDNKELDMTFSFHHLKVDYPNGEKWALAPFDF
LKLKEILSDWQTGMHAGGGWNALFWCNHDQPRVVSRYGDDGAYRVKSAKMLATAIHMMQG
TPYIYQGEELGMTNPKFTDISSYRDVESLNMYHAFKEKGMADQDITAILQAKSRDNSRTP
VQWDATENGGFTTGTPWIPVAGNYREINAEAALRDQNSVFYHYQKLIQIRKMYDIVTEGT
YEIIAKDDPNIFAYLRHGSNEKLLVINNFYGTEAAFTLPDSLAPDEWKAEVLLTNDEARE
GLQNMTLRPYESIVYRLTKPC
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgaaaacagaacaaacgccatggtggaaaaaagctgtggtttatcaaatttatccgaaa
agctttaacgatacgacaggaaatggtgttggcgatctgaacggcattattgaaaagctg
gattacttaaaaacgctacaggtggatgtgctttggctgacgccgatttatgattctccc
cagcatgataatgggtacgatattcgtgattattactcgatttatcctgaatacggaacg
atggaggattttgagcggctagtgtccgaagcacataaaagagacctgaaagtcgtcatg
gatcttgttgtcaatcatacgtcaacagagcacaaatggtttcgcgaggcgatctcttca
atagacagcccgtaccgtgatttttatatatggaaaaaaccgcaggaaaacggttctgtt
ccgacgaactgggaatcgaaattcggcggctcggcatgggagcttgacgaagcatcgggc
caatactatttgcatctgtttgatgtgacgcaggctgatttgaattgggaaaatgaagag
gtcagaaagcatgtctatgacatgatgcatttttggtttgaaaagggaatagacggcttt
aggcttgatgtcatcaacctgatttctaaagatcagcgctttccgaatgcggaggaaggc
gacggccgctctttttacactgacgggccgcgggtgcacgaatttctgcatgaaatgaac
gaaaaggtgttttcacattacgacagcatgacggtcggtgagatgtcttcaacaaccgta
gaccactgcatccggtatacgaatcctgacaataaagaacttgatatgacattcagcttc
catcatctcaaggttgactatcctaacggcgaaaaatgggccttggcgccgtttgatttt
ttgaagctgaaggagatcctatctgactggcaaacggggatgcacgcaggagggggatgg
aacgctctgttctggtgcaatcatgatcagccgcgcgtcgtatcaagatatggagatgat
ggcgcatatagggtgaaatcggcgaaaatgcttgctacggccattcatatgatgcagggc
acgccttatatttatcagggcgaggagctggggatgacgaatccgaagttcactgacata
agctcctatcgggatgtcgaatcgctgaacatgtatcacgcctttaaggaaaaaggaatg
gctgatcaagatattacagccattttacaggcgaaatcccgtgacaattccagaaccccc
gttcagtgggatgctacggaaaatggtggttttacaacgggcacaccatggataccggtt
gcaggaaattaccgggaaatcaatgctgaagcggcgctgagggatcagaattcggtgttt
taccattatcaaaaattgattcagattcgcaaaatgtatgacattgtgacagagggtacg
tatgagataattgcaaaggatgacccgaacatttttgcgtatctcagacacggcagcaat
gaaaagctgctcgtgatcaataatttttacgggacagaggcggcctttacactgccggac
tctttagcgcctgacgaatggaaggcagaggtgctgttgacgaacgatgaagcaagggaa
gggcttcagaacatgacgcttcgcccatatgagtccattgtttatcgtttaacgaaaccg
tgttaa

DBGET integrated database retrieval system