KEGG   Bacillus subtilis subsp. subtilis 168: BSU07840
Entry
BSU07840          CDS       T00010                                 

Gene name
yfkN
Definition
(RefSeq) nucleotide phosphoesterase
  KO
K08693  2',3'-cyclic-nucleotide 2'-phosphodiesterase / 3'-nucleotidase / 5'-nucleotidase [EC:3.1.4.16 3.1.3.6 3.1.3.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU07840 (yfkN)
   00240 Pyrimidine metabolism
    BSU07840 (yfkN)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU07840 (yfkN)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     BSU07840 (yfkN)
    3.1.3.6  3'-nucleotidase
     BSU07840 (yfkN)
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.16  2',3'-cyclic-nucleotide 2'-phosphodiesterase
     BSU07840 (yfkN)
SSDB
Motif
Pfam: 5_nucleotid_C Metallophos
Other DBs
NCBI-GeneID: 936131
NCBI-ProteinID: NP_388665
Pasteur: BG12930
BSORF: BG12930
UniProt: O34313 A0A6M4JG22
Structure
PDB: 
3GVE

Position
complement(855114..859502)
AA seq 1462 aa
MRIQKRRTHVENILRILLPPIMILSLILPTPPIHAEESAAPQVHLSILATTDIHANMMDY
DYYSDKETADFGLARTAQLIQKHREQNPNTLLVDNGDLIQGNPLGEYAVKYQKDDIISGT
KTHPIISVMNALKYDAGTLGNHEFNYGLDFLDGTIKGADFPIVNANVKTTSGENRYTPYV
INEKTLIDENGNEQKVKVGYIGFVPPQIMTWDKKNLEGQVQVQDIVESANETIPKMKAEG
ADVIIALAHTGIEKQAQSSGAENAVFDLATKTKGIDAIISGHQHGLFPSAEYAGVAQFNV
EKGTINGIPVVMPSSWGKYLGVIDLKLEKADGSWKVADSKGSIESIAGNVTSRNETVTNT
IQQTHQNTLEYVRKPVGKTEADINSFFAQVKDDPSIQIVTDAQKWYAEKEMKDTEYKNLP
ILSAGAPFKAGGRNGANYYTNIPAGDLAIKNVGDLYLYDNTVQIVKLTGSEVKDWLEMSA
GQFNQIDPAKGGDQALLNENFRSYNFDVIDGVTYQVDVTKPAKYNENGKVINADSSRIIN
LSYEGKPISPSQEFLVVTNNYRASGGGGFPHLTSDKIVHGSAVENRQVLMDYIIEQKTVN
PKADNNWSIAPVSGTNLTFESSLLAKPFADKADDVAYVGKSANEGYGVYKLQFDDDSNPD
PPKDGLWDLTVMHTNDTHAHLDDAARRMTKINEVRSETNHNILLDAGDVFSGDLYFTKWN
GLADLKMMNMMGYDAMTFGNHEFDKGPTVLSDFLSGNSATVDPANRYHFEAPEFPIVSAN
VDVSNEPKLKSFVKKPQTFTAGEKKEAGIHPYILLDVDGEKVAVFGLTTEDTATTSSPGK
SIVFNDAFETAQNTVKAIQEEEKVNKIIALTHIGHNRDLELAKKVKGIDLIIGGHTHTLV
DKMEVVNNEEPTIVAQAKEYGQFLGRVDVAFDEKGVVQTDKSNLSVLPIDEHTEENPEAK
QELDQFKNELEDVKNEKVGYTDVALDGQREHVRTKETNLGNFIADGMLAKAKEAAGARIA
ITNGGGIRAGIDKGDITLGEVLNVMPFGNTLYVADLTGKQIKEALEQGLSNVENGGGAFP
QVAGIEYTFTLNNKPGHRVLEVKIESPNGDKVAINTDDTYRVATNNFVGAGGDGYSVFTE
ASHGEDLGYVDYEIFTEQLKKLGNKVSPKVEGRIKEVFLPTKQKDGSWTLDEDKFAIYAK
NANTPFVYYGIHEGSQEKPINLKVKKDQVKLLKERESDPSLTMFNYWYSMKMPMANLKTA
DTAIGIKSTGELDVSLSDVYDFTVKQKGKEIKSFKEPVQLSLRMFDIEEAHNPAIYHVDR
KKKAFTKTGHGSVDDDMVTGYTNHFSEYTILNSGSNNKPPAFPSDQPTGGDDGNHGGGSD
KPGGKQPTDGNGGNDTPPGTQPTNGSGGNGSGGSGTDGPAGGLLPDTATSMYSILLAGFL
ISALGTAMYLHQRRKQNRANQA
NT seq 4389 nt   +upstreamnt  +downstreamnt
gtgagaatacagaaaagacgaacacacgtcgaaaacattctccgtattcttttgccccca
attatgatacttagcctaatcctcccaacaccacccattcatgcagaagaaagcgcggct
cctcaggtgcatctgagtattttggctacgactgatattcatgccaacatgatggattac
gattactacagcgacaaagaaacggcggatttcggtctggcgagaacagcgcaattgatc
caaaagcaccgcgagcaaaaccctaacaccctgcttgtggataacggcgacttgattcaa
gggaatccgctgggtgaatacgcggtgaaatatcaaaaagacgacattatctccggcacg
aaaacccatccgattatcagcgtcatgaatgcgctgaaatacgacgccggaacgcttggc
aatcatgaattcaactacgggctcgactttctcgacggcacaatcaaaggagccgatttc
ccgattgtaaatgccaacgtcaaaacaactagcggcgaaaaccgttatacgccgtatgtg
attaatgaaaaaaccctcattgatgaaaacggtaatgagcagaaagtaaaagtcggctac
ataggctttgtcccgccgcaaatcatgacatgggacaaaaagaatctcgaggggcaagtt
caggtgcaggatatcgtagaatccgccaatgaaacgatcccgaaaatgaaggcggaaggc
gcagatgtcattattgccctcgcccacaccggcattgaaaagcaggcgcaatcatcaggc
gcagaaaacgccgtgtttgaccttgccaccaaaacgaaaggcattgacgcgattatctcg
ggccatcagcacggactctttccttccgccgagtatgcgggtgttgctcagttcaatgtg
gaaaagggaacaattaacggcattcctgtcgtcatgccaagcagctggggcaaatattta
ggcgtgattgacctcaagcttgaaaaggcggacggctcatggaaggtagcagattccaaa
ggaagtattgaatctattgctggcaacgtcacatcaagaaacgaaaccgttacaaacacc
attcagcaaacacaccaaaacacactggagtatgtccgaaagccagtcggcaaaaccgaa
gcagatattaacagcttctttgcacaggtcaaagatgatccttccattcagatcgtgact
gacgcgcaaaagtggtacgctgaaaaagaaatgaaggataccgagtacaagaacctgccg
attttatccgctggagcgccgtttaaagcaggcggcagaaacggagccaattactataca
aacattccagccggagatcttgcgattaaaaatgtcggtgacttgtatctttacgataat
actgttcaaatcgtcaagctgacaggcagcgaggtcaaggactggctggagatgtcagca
ggccaattcaatcaaattgatccagctaaaggcggcgaccaggccttgctgaacgagaat
ttccgctcctataattttgacgtgattgacggtgtcacatatcaggtcgatgtgacaaaa
ccggctaaatacaatgagaacggaaaagtgatcaatgcggattcatcccgtatcatcaat
ctttcctatgaaggcaagccgatcagcccaagccaggaatttctcgtagtcaccaataac
tatcgtgcgtccggaggcggcgggttccctcatctgacgagcgataaaattgtccacggc
tctgcagttgaaaataggcaggtgctgatggattacattattgaacaaaaaacagtcaat
ccaaaagcagacaacaactggtcaatcgcgcctgtttccggcacgaatctgacgtttgaa
tcctcgcttttggccaagccatttgccgataaagcagacgatgtcgcttatgtaggcaag
tctgcgaatgaaggctatggtgtgtataagctgcaattcgatgatgattcaaatccagat
cctcctaaagacggactgtgggatctgaccgtcatgcacaccaatgatacgcacgcccat
ctcgatgatgcagcgagacgaatgacgaaaatcaacgaagtacgcagcgaaacaaatcac
aatattctccttgatgcgggagatgtgttttccggcgatctgtattttactaaatggaac
ggtttggccgatctgaaaatgatgaacatgatgggctatgacgccatgaccttcggaaac
catgaatttgacaaaggcccgacggtgctttctgattttctaagcggaaacagcgcaacc
gttgatccggcgaaccgctatcactttgaagcgccggaatttccgattgtcagtgcaaac
gtagatgtgtcaaatgagcccaagctgaaatcatttgtcaaaaagccgcaaacctttacg
gcaggtgaaaagaaagaggccggcattcacccttacattctgttagacgttgacggggag
aaagtcgccgtattcggcctgacaacagaagatacagccaccacatcaagcccgggcaaa
agcatcgtattcaatgatgcctttgaaacagcacaaaacaccgtcaaagcgattcaagaa
gaagaaaaggtaaataaaattattgctttaacccacatcggacataaccgggatcttgag
ctagccaaaaaagtaaaaggcattgatttgatcatcggcggacacactcacaccctcgta
gacaaaatggaggtcgtgaacaacgaagaaccgacgatcgtggcgcaggcaaaagaatac
ggccaattcttggggcgcgttgatgtcgcgtttgatgaaaaaggcgttgtgcaaacagat
aaatcaaatctgagcgtgctgccaattgatgaacatacagaagaaaacccagaagcaaaa
caagagctcgatcagttcaaaaatgaattagaggacgtgaaaaatgaaaaagtcggctac
acggatgtggcgcttgacggccagcgtgagcatgtgcgcacgaaagaaacgaatctcgga
aacttcatcgcggacggtatgctggcaaaagcgaaagaagcagccggcgccagaatagcg
ataacaaatggcggcggcatcagagcaggcattgacaaaggtgatatcacactcggcgag
gtgctcaacgtgatgccgttcggcaatacgctttacgtggccgatttaaccggaaaacaa
attaaagaagcccttgaacaaggcctaagcaatgtggaaaatggcggcggcgctttccct
caggtggccggaatcgaatatacctttacattaaacaacaaacctggacaccgtgtgtta
gaagtgaaaattgaatcgcctaacggagacaaagttgctataaatacggatgatacctac
cgcgtggcaacaaataattttgtcggtgccggaggagacggatattctgtctttacagaa
gcctcccatggtgaagaccttggctacgttgattatgagattttcaccgaacagctgaaa
aaactaggaaacaaggtctctcctaaagttgaaggacgaatcaaagaagtattcctgccg
acaaagcagaaggacggcagctggacacttgatgaagacaaatttgcgatttatgctaaa
aatgccaacacgccatttgtctattatggaatacatgaaggatctcaagagaagcctatc
aatcttaaagtgaaaaaagatcaggtcaaacttttgaaagaaagagagtcagatccttca
ttgacgatgttcaactactggtacagcatgaagatgccaatggcgaaccttaaaaccgca
gacactgcaatcggaatcaagtctacgggagaattggatgtgtcactgtcagatgtatat
gactttacagtgaagcaaaaaggaaaagaaataaaatcattcaaggagcccgtacagctt
tcgcttcgcatgtttgatattgaagaagcccataaccctgccatttatcacgtcgataga
aaaaagaaagctttcacaaagacaggtcacggatcagtcgatgatgatatggtgacagga
tatacaaaccacttcagcgaatacacgatcttaaattccggttcaaacaacaaaccgccg
gcattcccgtcagatcaaccgacaggcggtgatgacggcaatcatggcggaggctccgac
aaaccaggcggaaaacagccaactgacggaaacggaggaaatgatacgcctcccggcact
caaccgactaacggctctggtggaaacggttcgggcggatcaggaacagacggtccggct
ggcggcctgcttccggacacagccacatccatgtactcgatcctgttggccggatttctg
atcagcgcactcggaacggcaatgtacttacatcagaggagaaaacagaatagagcgaat
caggcataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU16970
Entry
BSU16970          CDS       T00010                                 

Gene name
ymdB
Definition
(RefSeq) hypothetical protein
  KO
K09769  2',3'-cyclic-nucleotide 2'-phosphodiesterase [EC:3.1.4.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU16970 (ymdB)
   00240 Pyrimidine metabolism
    BSU16970 (ymdB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.16  2',3'-cyclic-nucleotide 2'-phosphodiesterase
     BSU16970 (ymdB)
SSDB
Motif
Pfam: YmdB Metallophos
Other DBs
NCBI-GeneID: 939441
NCBI-ProteinID: NP_389579
Pasteur: BG13421
BSORF: BG13421
UniProt: O31775 A0A6M4JGJ4
Structure
PDB: 
4B2O

Position
1768941..1769735
AA seq 264 aa
MRILFIGDVVGSPGRDMVKEYVPKLKTKYKPHFTIINGENAAHGKGLTEKIYHSLIQSGA
DAITMGNHTWDKKEIFDFIDDVPNLVRPANFPEGTPGKGITYVKANGKELAVINLQGRTF
LPPLDDPFLKADELIAEAAKRTPYIFIDFHAEATSEKLALGWYTDGRASAVVGTHTHVQT
ADNRILPKGTAYITDVGMTGPYDGILGMDRETIIKRFKTNLPVRFTVAEGKTTLSGVVID
IDDQTKKAVKIERILINDDHMFFE
NT seq 795 nt   +upstreamnt  +downstreamnt
atgagaattttatttatcggagatgttgtcggttcaccgggccgtgacatggtcaaagaa
tatgtaccaaagctaaaaacaaaatataagcctcactttaccattattaatggtgaaaac
gccgcacatggaaaaggcctgacggaaaaaatttatcacagcttaatccagtccggcgca
gatgcaatcacaatggggaaccacacatgggacaaaaaagaaatatttgattttatagat
gacgttccgaacttggttcgcccggcaaactttcctgaaggaacaccggggaaagggatc
acatatgtgaaagcaaacggcaaagaactagcagtcattaatttgcagggacgtacgttt
ttgccgccgcttgatgacccgtttttaaaagcggatgaattgatcgcagaagctgcgaaa
agaacaccgtacatttttattgactttcatgccgaagcgacaagtgaaaagctcgcactt
ggctggtacacggatggacgggcatcggctgtagtaggaactcatacacacgtgcaaaca
gcggataaccgcattttgccgaagggaacggcatatattactgatgtgggaatgactggc
ccgtatgacggtatactggggatggacagagagacgattattaagcgattcaaaacgaac
cttccagtccggtttactgtcgctgaaggaaaaacaacgctcagcggagttgtcattgac
attgacgatcaaacgaaaaaagccgtgaaaattgagcgtattttaatcaacgatgatcac
atgttctttgaatag

DBGET integrated database retrieval system