KEGG   Bacillus subtilis subsp. subtilis 168: BSU08090
Entry
BSU08090          CDS       T00010                                 
Symbol
acoL
Name
(RefSeq) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00020  Citrate cycle (TCA cycle)
bsu00260  Glycine, serine and threonine metabolism
bsu00280  Valine, leucine and isoleucine degradation
bsu00310  Lysine degradation
bsu00380  Tryptophan metabolism
bsu00620  Pyruvate metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01240  Biosynthesis of cofactors
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bsu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU08090 (acoL)
   00020 Citrate cycle (TCA cycle)
    BSU08090 (acoL)
   00620 Pyruvate metabolism
    BSU08090 (acoL)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU08090 (acoL)
   00640 Propanoate metabolism
    BSU08090 (acoL)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU08090 (acoL)
   00280 Valine, leucine and isoleucine degradation
    BSU08090 (acoL)
   00310 Lysine degradation
    BSU08090 (acoL)
   00380 Tryptophan metabolism
    BSU08090 (acoL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU08090 (acoL)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BSU08090 (acoL)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BSU08090 (acoL)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored DAO HI0933_like NAD_binding_8 AlaDh_PNT_C 3HCDH_N FAD_binding_2 UDPG_MGDP_dh_N Trp_halogenase NAD_binding_7 FAD_binding_3 Lycopene_cycl 2-Hacid_dh_C TrkA_N ApbA
Other DBs
NCBI-GeneID: 939702
NCBI-ProteinID: NP_388690
Pasteur: BG12561
UniProt: O34324 A0A6M3Z8G0
Position
882266..883642
AA seq 458 aa
MTLAIIGGGPAGYAAAVSAAQQGRNVLLIDKGKLGGTCLNEGCIPTKSLLESANVLDKIK
HADSFGIELPAGAISVDWSKMQSRKQQVVSQLVQGVQYLMKKNQIQVVKGTASFLSERKL
LIEGENGKEIREADQVLIASGSEPIELPFAPFDGEWILDSKDALSLSEIPSSLVIVGGGV
IGCEYAGLFARLGSQVTIIETADRLIPAEDEDIARLFQEKLEEDGVEVHTSSRLGRVDQT
AKTAIWKSGQREFKTKADYVLVAIGRKPRLDGLQLEQAGVDFSPKGIPVNGHMQTNVPHI
YACGDAIGGIQLAHAAFHEGIIAASHASGRDVKINEKHVPRCIYTSPEIACIGMTERQAR
SIYGDVKIGEFSFSANGKALIKQQAEGKVKIMAEPEFGEIVGVSMIGPDVTELIGQAAAI
MNGEMTADMAEHFIAAHPTLSETLHEALLSTIGLAVHA
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgacattagccattatcggcggcggacctgcaggctatgcggctgcggtttccgcggca
cagcagggcagaaacgtgctgctcattgacaaaggcaagcttggggggacctgcctgaat
gaaggctgcatcccgacaaagtctttgttagaaagcgcaaacgttcttgataaaatcaag
catgccgacagctttggaatcgaacttccggcaggtgcgatatcagtcgattggagtaaa
atgcaaagccgaaaacaacaggttgtcagtcagcttgtccaaggcgttcagtacctaatg
aagaaaaatcaaatacaggttgtaaagggaacagcctcctttctttctgaaagaaagctc
ttgatcgaaggagaaaacggaaaagaaatcagagaggcggaccaagtattgattgcctcc
gggtcagagccaatcgagctgccttttgccccatttgacggcgaatggatcctcgacagc
aaagacgcgctttctctttccgagattccgtcttcactagtcattgtcggcggcggtgtc
atcgggtgtgagtatgcagggctgttcgccagattgggatcgcaggtgaccatcattgaa
acagcggaccggctgatcccggctgaagatgaagatattgcccgtctctttcaggagaaa
cttgaggaagacggtgtcgaagtgcatacttcatccagattagggcgggtggatcaaacg
gccaaaacggcaatatggaaaagcggtcagcgagagtttaaaacgaaggccgattatgtg
ctggtggcgatcggcagaaaaccccgtcttgacggattgcagctggaacaggccggagtt
gatttttctccaaagggcattccggtgaatgggcacatgcagacgaacgtgcctcatatt
tacgcgtgcggagatgctatagggggcattcagctcgcgcatgccgctttccatgagggc
atcatcgctgcttctcatgcttccggaagggatgtcaaaatcaatgagaaacatgtgccg
cgctgcatctatacgtccccggaaatcgcgtgtatcggaatgacagaacgacaggcaaga
agcatatacggggatgtgaagatcggcgaattttcattttccgcaaacggcaaggcgctc
attaaacagcaagcggaaggaaaggtcaaaatcatggctgaaccggaattcggcgaaatc
gtgggtgtctcgatgattggcccggatgtaaccgagctcatcggccaagcggcagcgatc
atgaatggtgagatgacggcagatatggcggagcattttatcgccgcccatccgacttta
tcggaaacattgcatgaggcgctgttaagcacgatcggccttgcggtacatgcataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU14610
Entry
BSU14610          CDS       T00010                                 
Symbol
pdhD
Name
(RefSeq) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00020  Citrate cycle (TCA cycle)
bsu00260  Glycine, serine and threonine metabolism
bsu00280  Valine, leucine and isoleucine degradation
bsu00310  Lysine degradation
bsu00380  Tryptophan metabolism
bsu00620  Pyruvate metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01240  Biosynthesis of cofactors
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bsu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU14610 (pdhD)
   00020 Citrate cycle (TCA cycle)
    BSU14610 (pdhD)
   00620 Pyruvate metabolism
    BSU14610 (pdhD)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU14610 (pdhD)
   00640 Propanoate metabolism
    BSU14610 (pdhD)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU14610 (pdhD)
   00280 Valine, leucine and isoleucine degradation
    BSU14610 (pdhD)
   00310 Lysine degradation
    BSU14610 (pdhD)
   00380 Tryptophan metabolism
    BSU14610 (pdhD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU14610 (pdhD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BSU14610 (pdhD)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BSU14610 (pdhD)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like FAD_binding_3 NAD_binding_9 Amino_oxidase NAD_binding_8 DAO AlaDh_PNT_C UDPG_MGDP_dh_N Tox-PAAR-like Thi4 3HCDH_N Trp_halogenase
Other DBs
NCBI-GeneID: 939492
NCBI-ProteinID: NP_389344
Pasteur: BG10210
UniProt: P21880 A0A6M4JLF8
Position
1531870..1533282
AA seq 470 aa
MVVGDFPIETDTLVIGAGPGGYVAAIRAAQLGQKVTVVEKATLGGVCLNVGCIPSKALIN
AGHRYENAKHSDDMGITAENVTVDFTKVQEWKASVVNKLTGGVAGLLKGNKVDVVKGEAY
FVDSNSVRVMDENSAQTYTFKNAIIATGSRPIELPNFKYSERVLNSTGALALKEIPKKLV
VIGGGYIGTELGTAYANFGTELVILEGGDEILPGFEKQMSSLVTRRLKKKGNVEIHTNAM
AKGVEERPDGVTVTFEVKGEEKTVDADYVLITVGRRPNTDELGLEQVGIEMTDRGIVKTD
KQCRTNVPNIYAIGDIIEGPPLAHKASYEGKIAAEAIAGEPAEIDYLGIPAVVFSEPELA
SVGYTEAQAKEEGLDIVAAKFPFAANGRALSLNETDGFMKLITRKEDGLVIGAQIAGASA
SDMISELSLAIEGGMTAEDIAMTIHAHPTLGEITMEAAEVAIGSPIHIVK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggtagtaggagatttccctattgaaacagatactcttgtaattggtgcgggacctggc
ggctatgtagctgccatccgcgctgcacagcttggacaaaaagtaacagtcgttgaaaaa
gcaactcttggaggcgtttgtctgaacgttggatgtatcccttcaaaagcgctgatcaat
gcaggtcaccgttatgagaatgcaaaacattctgatgacatgggaatcactgctgagaat
gtaacagttgatttcacaaaagttcaagaatggaaagcttctgttgtcaacaagcttact
ggcggtgtagcaggtcttcttaaaggcaacaaagtagatgttgtaaaaggtgaagcttac
tttgtagacagcaattcagttcgtgttatggatgagaactctgctcaaacatacacgttt
aaaaacgcaatcattgctactggttctcgtcctatcgaattgccaaacttcaaatatagt
gagcgtgtcctgaattcaactggcgctttggctcttaaagaaattcctaaaaagctcgtt
gttatcggcggcggatacatcggaactgaacttggaactgcgtatgctaacttcggtact
gaacttgttattcttgaaggcggagatgaaattcttcctggcttcgaaaaacaaatgagt
tctctcgttacacgcagactgaagaaaaaaggcaacgttgaaatccatacaaacgcgatg
gctaaaggcgttgaagaaagaccagacggcgtaacagttactttcgaagtaaaaggcgaa
gaaaaaactgttgatgctgattacgtattgattacagtaggacgccgtccaaacactgat
gagcttggtcttgagcaagtcggtatcgaaatgacggaccgcggtatcgtgaaaactgac
aaacagtgccgcacaaacgtacctaacatttatgcaatcggtgatatcatcgaaggaccg
ccgcttgctcataaagcatcttacgaaggtaaaatcgctgcagaagctatcgctggagag
cctgcagaaatcgattaccttggtattcctgcggttgttttctctgagcctgaacttgca
tcagttggttacactgaagcacaggcgaaagaagaaggtcttgacattgttgctgctaaa
ttcccatttgcagcaaacggccgcgcgctttctcttaacgaaacagacggcttcatgaag
ctgatcactcgtaaagaggacggtcttgtgatcggtgcgcaaatcgccggagcaagtgct
tctgatatgatttctgaattaagcttagcgattgaaggcggcatgactgctgaagatatc
gcaatgacaattcacgctcacccaacattgggcgaaatcacaatggaagctgctgaagtg
gcaatcggaagtccgattcacatcgtaaaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU24060
Entry
BSU24060          CDS       T00010                                 
Symbol
lpdV
Name
(RefSeq) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00020  Citrate cycle (TCA cycle)
bsu00260  Glycine, serine and threonine metabolism
bsu00280  Valine, leucine and isoleucine degradation
bsu00310  Lysine degradation
bsu00380  Tryptophan metabolism
bsu00620  Pyruvate metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01240  Biosynthesis of cofactors
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bsu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU24060 (lpdV)
   00020 Citrate cycle (TCA cycle)
    BSU24060 (lpdV)
   00620 Pyruvate metabolism
    BSU24060 (lpdV)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU24060 (lpdV)
   00640 Propanoate metabolism
    BSU24060 (lpdV)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU24060 (lpdV)
   00280 Valine, leucine and isoleucine degradation
    BSU24060 (lpdV)
   00310 Lysine degradation
    BSU24060 (lpdV)
   00380 Tryptophan metabolism
    BSU24060 (lpdV)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU24060 (lpdV)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BSU24060 (lpdV)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BSU24060 (lpdV)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA FAD_binding_2 Pyr_redox_3 FAD_oxidored AlaDh_PNT_C FAD_binding_3 NAD_binding_8 Lys_Orn_oxgnase HI0933_like Thi4 3HCDH_N DAO Trp_halogenase NAD_binding_7 2-Hacid_dh_C RepB
Other DBs
NCBI-GeneID: 938669
NCBI-ProteinID: NP_390286
Pasteur: BG11725
UniProt: P54533 A0A6M4JL69
Position
complement(2500104..2501528)
AA seq 474 aa
MATEYDVVILGGGTGGYVAAIRAAQLGLKTAVVEKEKLGGTCLHKGCIPSKALLRSAEVY
RTAREADQFGVETAGVSLNFEKVQQRKQAVVDKLAAGVNHLMKKGKIDVYTGYGRILGPS
IFSPLPGTISVERGNGEENDMLIPKQVIIATGSRPRMLPGLEVDGKSVLTSDEALQMEEL
PQSIIIVGGGVIGIEWASMLHDFGVKVTVIEYADRILPTEDLEISKEMESLLKKKGIQFI
TGAKVLPDTMTKTSDDISIQAEKDGETVTYSAEKMLVSIGRQANIEGIGLENTDIVTENG
MISVNESCQTKESHIYAIGDVIGGLQLAHVASHEGIIAVEHFAGLNPHPLDPTLVPKCIY
SSPEAASVGLTEDEAKANGHNVKIGKFPFMAIGKALVYGESDGFVKIVADRDTDDILGVH
MIGPHVTDMISEAGLAKVLDATPWEVGQTIHPHPTLSEAIGEAALAADGKAIHF
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggcaactgagtatgacgtagtcattctgggcggcggtaccggcggttatgttgcggcc
atcagagccgctcagctcggcttaaaaacagccgttgtggaaaaggaaaaactcggggga
acatgtctgcataaaggctgtatcccgagtaaagcgctgcttagaagcgcagaggtatac
cggacagctcgtgaagccgatcaattcggagtggaaacggctggcgtgtccctcaacttt
gaaaaagtgcagcagcgtaagcaagccgttgttgataagcttgcagcgggtgtaaatcat
ttaatgaaaaaaggaaaaattgacgtgtacaccggatatggacgtatccttggaccgtca
atcttctctccgctgccgggaacaatttctgttgagcggggaaatggcgaagaaaatgac
atgctgatcccgaaacaagtgatcattgcaacaggatcaagaccgagaatgcttccgggt
cttgaagtggacggtaagtctgtactgacttcagatgaggcgctccaaatggaggagctg
ccacagtcaatcatcattgtcggcggaggggttatcggtatcgaatgggcgtctatgctt
catgattttggcgttaaggtaacggttattgaatacgcggatcgcatattgccgactgaa
gatctagagatttcaaaagaaatggaaagtcttcttaagaaaaaaggcatccagttcata
acaggggcaaaagtgctgcctgacacaatgacaaaaacatcagacgatatcagcatacaa
gcggaaaaagacggagaaaccgttacctattctgctgagaaaatgcttgtttccatcggc
agacaggcaaatatcgaaggcatcggcctagagaacaccgatattgttactgaaaatggc
atgatttcagtcaatgaaagctgccaaacgaaggaatctcatatttatgcaatcggagac
gtaatcggtggcctgcagttagctcacgttgcttcacatgagggaattattgctgttgag
cattttgcaggtctcaatccgcatccgcttgatccgacgcttgtgccgaagtgcatttac
tcaagccctgaagctgccagtgtcggcttaaccgaagacgaagcaaaggcgaacgggcat
aatgtcaaaatcggcaagttcccatttatggcgattggaaaagcgcttgtatacggtgaa
agcgacggttttgtcaaaatcgtggctgaccgagatacagatgatattctcggcgttcat
atgattggcccgcatgtcaccgacatgatttctgaagcgggtcttgccaaagtgctggac
gcaacaccgtgggaggtcgggcaaacgattcacccgcatccaacgctttctgaagcaatt
ggagaagctgcgcttgccgcagatggcaaagccattcatttttaa

DBGET integrated database retrieval system