KEGG   Bacillus subtilis subsp. subtilis 168: BSU08180
Entry
BSU08180          CDS       T00010                                 

Symbol
malA
Name
(RefSeq) maltose-6'-phosphate glucosidase
  KO
K01232  maltose-6'-phosphate glucosidase [EC:3.2.1.122]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU08180 (malA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.122  maltose-6'-phosphate glucosidase
     BSU08180 (malA)
SSDB
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Other DBs
NCBI-GeneID: 936161
NCBI-ProteinID: NP_388699
Pasteur: BG11839
BSORF: BG11839
UniProt: P54716 A0A6M4JJN1
Structure
PDB: 
1U8X

Position
890022..891371
AA seq 449 aa
MKKKSFSIVIAGGGSTFTPGIVLMLLDHLEEFPIRKLKLYDNDKERQDRIAGACDVFIRE
KAPDIEFAATTDPEEAFTDVDFVMAHIRVGKYAMRALDEQIPLKYGVVGQETCGPGGIAY
GMRSIGGVLEILDYMEKYSPDAWMLNYSNPAAIVAEATRRLRPNSKILNICDMPVGIEDR
MAQILGLSSRKEMKVRYYGLNHFGWWTSIQDQEGNDLMPKLKEHVSQYGYIPKTEAEAVE
ASWNDTFAKARDVQAADPDTLPNTYLQYYLFPDDMVKKSNPNHTRANEVMEGREAFIFSQ
CDMITREQSSENSEIKIDDHASYIVDLARAIAYNTGERMLLIVENNGAIANFDPTAMVEV
PCIVGSNGPEPITVGTIPQFQKGLMEQQVSVEKLTVEAWAEKSFQKLWQALILSKTVPNA
RVARLILEDLVEANKDFWPELDQSPTRIS
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaagaaaaaatcattctcaatcgtaatagcgggcggagggagcactttcactccaggg
atcgtactcatgctcttggaccatttggaggagtttccgatcagaaagctgaagctgtat
gataatgataaggagagacaggatcgaattgcaggcgcctgtgacgtttttatcagagaa
aaagcgccggatattgaatttgcagcgacgactgacccggaagaagcttttacagatgtc
gattttgttatggcgcacatcagagtagggaaatacgcgatgcgcgcgcttgatgagcaa
attccgttaaagtacggagttgtcggccaggagacgtgcgggccgggcgggatcgcatac
ggtatgcgttcgatcggcggtgtgcttgaaatattagattacatggaaaaatactcgcct
gatgcgtggatgctcaattattccaatccggcggcaattgtggctgaagctacgagacgc
cttagaccgaattctaaaattctcaatatctgtgatatgccggttgggatcgaagaccgg
atggcgcaaattcttggcttatcctcaagaaaagaaatgaaggtccgctattacggattg
aatcatttcggctggtggacatcgattcaggatcaagagggcaacgatttaatgccgaag
ctgaaggaacatgtatcccaatacggttatattccgaaaacagaggctgaagctgtggag
gcaagctggaatgacacgttcgccaaagcgcgtgacgtgcaggctgcagatcctgacaca
ctgccgaatacgtatttgcaatattatttgttcccagatgatatggtgaaaaaatcaaat
ccgaatcatacgcgggcgaatgaagtcatggaagggcgcgaagcttttattttcagccaa
tgtgacatgatcacacgtgaacagtcctcggaaaacagcgaaattaaaatcgatgaccac
gcatcgtatatcgttgatcttgcccgggcgattgcctacaacacaggtgaaagaatgctg
ttgattgttgaaaataacggtgcaattgcgaactttgacccgactgcgatggttgaggtg
ccatgcatcgtcggctcaaatggacctgaaccgattaccgttggcaccattccgcaattc
cagaaagggctcatggagcagcaggtatccgttgagaagctgactgttgaagcgtgggca
gagaaatcgttccaaaagctgtggcaggcgctgatcctgtcaaaaacagtgccgaacgcg
cgtgtggcaagactcattcttgaggatttagtggaggccaacaaagacttctggcctgag
cttgatcaaagcccaacccgcatatcataa

DBGET integrated database retrieval system