KEGG   Bacillus subtilis subsp. subtilis 168: BSU08790
Entry
BSU08790          CDS       T00010                                 

Symbol
thiC
Name
(RefSeq) phosphomethylpyrimidine synthase
  KO
K03147  phosphomethylpyrimidine synthase [EC:4.1.99.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00895  Thiamine biosynthesis, prokaryotes, AIR (+ DXP/glycine) => TMP/TPP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU08790 (thiC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.17  phosphomethylpyrimidine synthase
     BSU08790 (thiC)
SSDB
Motif
Pfam: ThiC_Rad_SAM ThiC-associated
Other DBs
NCBI-GeneID: 939745
NCBI-ProteinID: NP_388759
Pasteur: BG11246
BSORF: BG11246
UniProt: P45740 A0A6M4JEI9
Position
955895..957667
AA seq 590 aa
MQNNSVQQANISIMSSFSGSKKVYVEGSSSDIQVPMREIALSPTTGSFGEEENAPVRVYD
TSGPYTDPEVTINIQEGLKPLRQKWITERGDVEEYEGRAIKPEDNGYKKAKPNVSYPGLK
RKPLRAKAGQNVTQMHYAKKGIITPEMEFIAIREHVSPEFVRDEVASGRAIIPSNINHPE
SEPMIIGRNFHVKINANIGNSAVTSSIEEEVEKMTWAIRWGADTMMDLSTGKDIHTTREW
IIRNCPVPVGTVPIYQALEKVNGVAEDLTWEIYRDTLIEQAEQGVDYFTIHAGVLLRYVP
LTAKRTTGIVSRGGAIMAQWCLAHHQESFLYTHFEEICEIMKMYDIAFSLGDGLRPGSIA
DANDEAQFAELETLGELTQIAWKHDVQVMIEGPGHVPMHKIKENVDKQMDICKEAPFYTL
GPLTTDIAPGYDHITSAIGAAMIGWYGTAMLCYVTPKEHLGLPNRDDVREGVITYKIAAH
AADLAKGHPGAQIRDDALSKARFEFRWRDQFNLSLDPERALEYHDETLPAEGAKTAHFCS
MCGPKFCSMRISQDIRDYAKKNDLSEAEAINKGLKEKAKEFVDTGSNLYQ
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgcaaaacaattcagtgcagcaagccaacatttccattatgtcaagtttttcaggcagc
aagaaggtatacgtggagggttcttcttcggacatccaagtgccgatgagggagattgca
ttgagtccgacgacgggatcgttcggcgaagaggaaaacgcgcctgtgcgtgtctatgat
acaagcggaccgtatacggaccctgaagtaaccattaatattcaagaaggattaaagccg
ctccgccaaaaatggatcacagagcgcggtgacgtggaagagtatgaaggtcgggctata
aaaccagaagataacggttataaaaaagcaaaaccaaacgtaagctatccaggattaaag
cggaaaccgctgagggcgaaggcaggtcaaaatgtcacacaaatgcactatgcaaaaaag
gggatcattacacctgagatggaatttatcgccattcgtgagcatgtgtctcctgaattc
gtcagagacgaggtagccagcggccgggcgattattccttcaaacattaatcaccctgaa
agtgagccaatgattatcggccggaattttcatgtgaagattaatgcaaatatcgggaat
tcagcggttacgtcatccattgaagaagaagtggaaaaaatgacgtgggccatccgctgg
ggagcggatacgatgatggatctctctaccggaaaagatattcatacgacgcgtgaatgg
attatccgcaattgccccgtgcctgtgggaactgttccgatttatcaggcgcttgaaaaa
gtaaacggcgtagctgaggatttaacgtgggagatttatcgtgatacgctaatcgagcag
gcagagcagggagtggattattttacgattcacgcgggtgttttgcttaggtatgtaccg
ctgactgccaaacggacaactggtatcgtgtcacgcgggggagcgattatggcgcagtgg
tgtctggctcatcatcaagaaagctttttatacacacattttgaagaaatatgtgagatt
atgaaaatgtatgatattgctttctctcttggggatggtttgcgtcccggatcaattgct
gatgccaatgacgaagcgcagtttgctgaattagagacgcttggagagctgacgcaaatt
gcctggaagcatgatgttcaggtgatgattgagggtcctggacatgttccgatgcataaa
atcaaagagaacgtcgataaacaaatggacatttgtaaagaagcgcctttttacacattg
gggccgttgacaacggatattgctccgggatatgaccatattacttcagcgatcggagcg
gcgatgatcggttggtacgggacagcaatgctttgttatgtaacgccgaaggagcatttg
gggctgccaaaccgtgatgatgttcgtgaaggagtcattacatataagatcgctgcgcac
gctgcggaccttgcaaaagggcatcccggagcgcaaatccgggatgatgcgttatcgaaa
gcccgttttgaattccgctggcgggatcagtttaatttatctcttgatccggagagagcc
cttgaataccatgatgaaaccctgcctgctgaaggagcaaaaaccgctcacttttgttcc
atgtgcggtccgaaattttgcagcatgagaatttcacaggatattcgggattatgcgaag
aaaaacgatctcagtgaagcagaagccataaataaaggattaaaagaaaaagcaaaagag
tttgtcgatacgggaagcaatttatatcaataa

DBGET integrated database retrieval system