KEGG   Bacillus subtilis subsp. subtilis 168: BSU10250
Entry
BSU10250          CDS       T00010                                 

Gene name
yhfJ
Definition
(RefSeq) lipoate-protein ligase LplJ
  KO
K03800  lipoate---protein ligase [EC:6.3.1.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00785  Lipoic acid metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    BSU10250 (yhfJ)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.20  lipoate---protein ligase
     BSU10250 (yhfJ)
SSDB
Motif
Pfam: Lip_prot_lig_C BPL_LplA_LipB
Other DBs
NCBI-GeneID: 939310
NCBI-ProteinID: NP_388906
Pasteur: BG13055
BSORF: BG13055
UniProt: O07608 A0A6M4JGL4
Position
1099159..1100154
AA seq 331 aa
MLFIDNQNINDPRINLAIEEYCVKHLDPEQQYLLFYVNQPSIIIGKNQNTIEEINTKYVE
ENGIIVVRRLSGGGAVYHDLGNLNFSFITKDDGDSFHNFKKFTEPVIQALHQLGVEAELS
GRNDIVVDGRKISGNAQFATKGRIFSHGTLMFDSAIDHVVSALKVKKDKIESKGIKSIRS
RVANISEFLDDKMTTEEFRSHLLRHIFNTNDVGNVPEYKLTEKDWETIHQISKERYQNWD
WNYGRSPKFNLNHSKRYPVGSIDLHLEVKKGKIEDCKIFGDFFGVGDVSEIENLLVGKQY
ERSVIADVLEGVNLKHYFGNITKEDFLDLIY
NT seq 996 nt   +upstreamnt  +downstreamnt
atgttatttatagacaatcaaaatatcaatgatccgcggatcaatcttgctatcgaggag
tactgtgtaaagcatttagaccctgaacagcaatatttgctcttttatgtgaatcaaccg
tctattatcattgggaaaaaccaaaatacaatagaagaaatcaatacaaaatatgttgag
gaaaacgggattatcgtcgtccgccgtttatcaggcgggggcgctgtgtaccatgatctg
gggaacttgaacttcagctttattaccaaggatgacggggacagctttcataactttaaa
aaattcactgagccagtgattcaggcgttacatcagcttggggttgaagccgaattaagc
ggccggaacgacattgtagtagatggccggaaaatatccggaaacgctcagtttgcaacg
aaaggccgtattttcagccacggcaccctcatgtttgattcagccattgatcatgttgta
tcagcattaaaggtgaaaaaggataaaattgaatcaaaaggcatcaaatcgatcagaagc
cgagtggcaaacatcagtgagtttctcgatgataaaatgaccaccgaagaattccgcagc
catttgcttcgccatatttttaacacaaacgacgttggaaacgtgccggagtataagctg
acggaaaaagattgggagaccattcatcaaatttcgaaagagcgctatcagaattgggat
tggaactacggccgctcaccaaaatttaaccttaatcattcgaagcgttatccggttgga
tcgatcgatttgcacctggaagtcaagaaaggcaaaatcgaggactgcaaaatcttcgga
gatttcttcggtgtcggtgatgtatctgaaattgaaaacctgctggtcggaaaacaatac
gaacgcagcgtcatcgctgatgtgctcgaaggtgtgaatctcaagcattactttgggaac
attacgaaagaggatttccttgatctgatttactaa

DBGET integrated database retrieval system