KEGG   Bacillus subtilis subsp. subtilis 168: BSU10920
Entry
BSU10920          CDS       T00010                                 

Gene name
sat
Definition
(RefSeq) sulfate adenylyltransferase
  KO
K00958  sulfate adenylyltransferase [EC:2.7.7.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00261  Monobactam biosynthesis
bsu00450  Selenocompound metabolism
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
Module
bsu_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU10920 (sat)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU10920 (sat)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BSU10920 (sat)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BSU10920 (sat)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     BSU10920 (sat)
SSDB
Motif
Pfam: ATP-sulfurylase PUA_2
Other DBs
NCBI-GeneID: 939334
NCBI-ProteinID: NP_388973
Pasteur: BG13106
BSORF: BG13106
UniProt: O06736 A0A6M3ZEK6
Position
complement(1170473..1171642)
AA seq 389 aa
MNGNEPHGGVLINRCDPACHFEGCACQAELDQLALSDLELIAIGGYSPLTGFLGEKDYHS
VVKEMRLANGLPWSLPITLPVGEKTARQLSAGDHVKLVKDGVTYGMITVTDIYQPDKTQE
ALSVFKTNDPAHPGVKKLLARPDYYIGGPITVSSLPDKSFEQFYATPAETRAAFQKLGWK
TIVGFQTRNPVHRAHEYIQKTALETVDGLLLHPLVGETKSDDIPSDIRMESYQALLNHYY
PKDRVMLSVFPAAMRYAGPREAIFHALVRKNYGCTHFIVGRDHAGVGSYYGTYDAQNIFQ
SFTEEELGIKPLFFEHSFYCRKCGNMGTSKTCPHSPRDHIHLSGTKVRELLRQGKKPPKE
FSRPEVAAVLIKGLHQQPVAIKQNSGELQ
NT seq 1170 nt   +upstreamnt  +downstreamnt
ttgaatggaaacgaaccccacggaggggtattaatcaaccgctgtgatcccgcatgccat
tttgaagggtgcgcgtgccaagcagagctggatcagcttgcactgagtgatctggagctt
attgcgatcggcggctacagcccgttaacaggttttttgggagaaaaagattatcattcc
gttgtgaaagagatgaggctggcaaacggcttgccgtggagcctgccgattacgctgcct
gtcggagaaaaaacagcaagacagctgtctgccggagatcacgtcaagcttgtgaaagac
ggtgttacctacggcatgatcacagtcaccgatatataccagcctgataaaacacaagaa
gcactgtctgtttttaaaacaaacgatcctgcccacccaggcgtaaaaaaattgctggcg
cgcccggattactatatcggagggcctatcacggtcagcagcctgcctgacaaatctttc
gaacagttttatgcaacgcccgctgaaacaagagcggcctttcaaaaactcggctggaag
acgattgtcggctttcaaaccaggaaccctgttcacagagcgcatgaatacattcaaaaa
acagcgttagaaacggtcgacggtctgctgcttcacccacttgtcggagaaacaaagtca
gacgatatccccagcgatatcagaatggagagctaccaggctttgcttaatcactattat
ccaaaggatcgtgtcatgttatcggttttccctgccgccatgcgttatgcaggtccgcgg
gaagcgattttccatgcgctcgtccgaaaaaattacggctgtacccattttattgtaggc
cgtgatcacgcgggtgtcggcagctactatggaacatacgacgcccaaaatatttttcaa
tcattcacagaggaagagctgggcatcaagccgctgttttttgagcacagcttttattgc
cgaaaatgcggaaacatgggcacctccaaaacatgtccgcacagcccgagagaccacatc
cacttatcaggcacaaaagtgagagagcttctccgccaaggcaaaaagccgcctaaagaa
ttcagccggcctgaggtcgcagccgtgctgatcaagggacttcaccaacagcctgttgcc
atcaagcaaaacagcggggaattgcaatga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU15590
Entry
BSU15590          CDS       T00010                                 

Gene name
sat
Definition
(RefSeq) sulfate adenylyltransferase
  KO
K00958  sulfate adenylyltransferase [EC:2.7.7.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00261  Monobactam biosynthesis
bsu00450  Selenocompound metabolism
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
Module
bsu_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU15590 (sat)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU15590 (sat)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BSU15590 (sat)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BSU15590 (sat)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     BSU15590 (sat)
SSDB
Motif
Pfam: ATP-sulfurylase PUA_2
Other DBs
NCBI-GeneID: 936726
NCBI-ProteinID: NP_389442
Pasteur: BG13378
BSORF: BG13378
UniProt: O34764 A0A6M3ZAX3
Position
1632208..1633356
AA seq 382 aa
MSLAPHGGTLVNRVDESYDVSGIQKEIELDLISFADLELIGIGAYSPIEGFFNEKDYVSV
VENMRLSSGVVWSLPITLPVDAQKAAELSLGETVKLTYEGETYGVIQIEDLYVPDKQKEA
VNVYKTDEQEHPGVKKLFSRGNTYVGGPITLIKKASKQFPEFTFEPSETRRQFAEKGWET
IVGFQTRNPVHRAHEYIQKTALETVDGLFLNPLVGETKSDDIPADVRMESYQVLLDHYYP
KDRVFLGVFLAAMRYAGPREAIFHALVRKNYGCTHFIVGRDHAGVGDYYGTYEAQELFDT
FKPEELGITPLKFEHSFFCKKCGNMGTAKTCPHGREHHVILSGTKVRGMLRDGVLPPAEF
SRKEVVEVLIKGMKKKEEVGVS
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgagcttagcaccacacggaggaacattagtaaacagagtagatgaatcatatgatgtg
agcggcattcaaaaagaaattgaacttgatttaatttctttcgcggatttggaattgatc
ggtatcggtgcatacagcccgattgaaggtttctttaatgaaaaagattacgtatcagtg
gtcgaaaacatgcgtctttcttccggcgttgtctggtctcttccaatcacgcttccggtc
gatgcgcaaaaagcagcggaactgtcacttggtgaaacggtaaagttaacgtatgaagga
gaaacttacggcgttatccaaatcgaagacctgtacgtgcctgacaaacaaaaagaagct
gtcaatgtgtacaaaacagatgaacaggagcatcctggtgttaaaaagctgttcagccgc
ggcaatacatatgtcggcggaccgattacgttgattaaaaaagcttcaaaacagttccct
gaatttacatttgaaccgtcagaaacgagacgccagtttgcggaaaaaggctgggaaacc
attgtcggtttccaaacaagaaaccctgttcacagagcgcatgaatacattcaaaaaacg
gctcttgaaacagtagacggcttgttcttgaatccgttagtaggtgaaacaaaatctgat
gacattccagctgatgtacggatggaaagctaccaagtgcttcttgatcattattacccg
aaagatcgtgttttccttggtgtctttttagcggcgatgcgttatgcaggcccgagagaa
gcaattttccacgcgcttgtcagaaagaactacggctgcacacatttcatcgtcggccgt
gatcatgcaggtgtaggcgactattacggaacatacgaagcacaggaactgtttgacaca
tttaaacctgaagaactcggaattacaccgctgaaatttgagcacagcttcttctgtaaa
aaatgcggaaatatgggaacagcaaaaacttgccctcatggcagagagcatcacgtcatt
ttatcaggcactaaggtaagaggtatgctgagagacggtgtgctgccgcctgctgaattc
agtcgaaaagaagtagtagaagtgttaatcaaagggatgaagaaaaaagaagaagtaggc
gtatcttaa

DBGET integrated database retrieval system