KEGG   Bacillus subtilis subsp. subtilis 168: BSU12080
Entry
BSU12080          CDS       T00010                                 
Symbol
ctaO
Name
(RefSeq) protoheme IX farnesyltransferase
  KO
K02257  heme o synthase [EC:2.5.1.141]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu00860  Porphyrin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU12080 (ctaO)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    BSU12080 (ctaO)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bsu01006]
    BSU12080 (ctaO)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU12080 (ctaO)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.141  heme o synthase
     BSU12080 (ctaO)
Prenyltransferases [BR:bsu01006]
 Compound prenylation
  Protoheme farnesyltransferase
   BSU12080 (ctaO)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    BSU12080 (ctaO)
SSDB
Motif
Pfam: UbiA PseudoU_synth_1
Other DBs
NCBI-GeneID: 939825
NCBI-ProteinID: NP_389090
Pasteur: BG13183
UniProt: O31652 A0A6M4JH25
Position
complement(1279514..1280503)
AA seq 329 aa
MQFWGRRLFLENTRDSAAISETKYIKASNRVTIYDFIKLAKPGIIISNSIAAFGGFWIAF
ASAEKTLTGLAFLMTMVTAMLGTAFVMASGTVYNNYFDRHMDAKMARTRSRASVTGKMPP
AMILTYGSVLGIAGLAMLYSLNPLTAFLGLAAFIFYAIIYTVWVKRTSVWSTFVGSFPGA
APPLMGYCAVTGDFSMTAVLLYTIMFLWQPPHFWAIGIRRKEEYRAAGVPLLPVVKGNHV
TKIKMMQYIAVLVPVTLLFPFSLGTGHISPFYFLAALVLGGIWIKKSIKGFKTDDDVKWA
KDMFVYSLIYFCLLFFIMMIDSFMMFLIR
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcagttttgggggaggcgtctatttttggagaatacaagagattctgcagccatatct
gaaacaaaatacataaaagcttcgaaccgggtaaccatttacgattttatcaaacttgca
aagccgggcattatcatatcaaactcgatagcagccttcggcgggttttggatcgcgttt
gcaagcgcagaaaaaacgttaaccggcttggcttttttgatgacaatggtaacagcaatg
ttgggaaccgcgtttgtgatggcttccggcactgtctataacaactattttgatcggcat
atggacgcaaaaatggcacgaactcgcagcagggcctcggtcacagggaaaatgccgcca
gccatgatcttaacatatggctctgttttaggaatcgcaggtcttgccatgctttattcc
ctcaatccattaacggcctttctcggactggccgcctttattttttatgcgatcatctat
acggtatgggtgaaacgaacgtctgtgtggagcacatttgtcgggagcttcccaggagct
gcgccgccattgatggggtattgtgccgtaaccggtgacttcagtatgacagcagtgctg
ttgtacacgattatgtttctgtggcagccgccgcatttttgggcgattgggataagacgc
aaagaggaatatcgcgctgctggcgttccgctcttgccagtagtcaaaggcaatcatgta
acaaaaataaaaatgatgcaatatattgccgtcctggtgccggtcacgctattatttcct
ttctctctcggcaccggccatataagcccattttatttcttagccgccttggttctcgga
ggcatatggatcaaaaaaagcatcaaaggattcaaaacagacgatgacgtgaagtgggca
aaggatatgtttgtctactcgcttatttatttttgcttgctgttcttcatcatgatgatc
gattcatttatgatgtttctgatcagatga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU14880
Entry
BSU14880          CDS       T00010                                 
Symbol
ctaB
Name
(RefSeq) protoheme IX farnesyltransferase 2
  KO
K02257  heme o synthase [EC:2.5.1.141]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu00860  Porphyrin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU14880 (ctaB)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    BSU14880 (ctaB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bsu01006]
    BSU14880 (ctaB)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU14880 (ctaB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.141  heme o synthase
     BSU14880 (ctaB)
Prenyltransferases [BR:bsu01006]
 Compound prenylation
  Protoheme farnesyltransferase
   BSU14880 (ctaB)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    BSU14880 (ctaB)
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-GeneID: 935922
NCBI-ProteinID: NP_389371
Pasteur: BG10214
UniProt: P24009 A0A6M3ZAR5
Position
1559309..1560226
AA seq 305 aa
MANSRILNDTAIDGQIEETTAWKDFLSLIKIGIVNSNLITTFTGMWLALHISGLSFLGNI
NTVLLTLIGSSLIIAGSCAINNWYDRDIDHLMERTKVRPTVTGKIQPSQALWSGILLVAL
GLIMLLMTTVMAAVIGFIGVFTYVVLYTMWTKRRYTINTVVGSVSGAVPPLIGWTAVEGN
IGVVAWVLFMILFIWQIPHFLALAIKKTEDYRAANIPMLPVVYGFEVTKRQIIVWVACLM
PLPFFLGSLGLPIVILGLLLNIGWLILGLMGFRSKNIMKWATQMFVYSLNYMTIYFVAMV
VLTLF
NT seq 918 nt   +upstreamnt  +downstreamnt
atggctaactccagaatcttaaatgatacagctatagacggacaaattgaagaaacaacg
gcatggaaagattttctgtcccttattaaaatagggatcgtcaattctaacctcatcacg
actttcactggaatgtggcttgcactgcatatatccggtttaagttttttaggcaatata
aacaccgttcttcttacgttaatcgggtcttcactgattattgcgggctcctgcgcgatc
aataactggtatgaccgggacattgaccatcttatggagcgtacgaaagtaagaccgacg
gttacgggtaaaattcagccgagtcaggcgttatggtctggaattttgctggttgcttta
ggattgatcatgctgctgatgacaactgtcatggctgctgttatcggttttatcggagtc
tttacgtatgttgtattgtacacaatgtggacgaaacgccgctatacgattaacacagta
gtaggaagcgtttccggtgcagtgccgccgcttattggatggacggcagtggaagggaat
atcggtgtcgtagcatgggtgttattcatgattttatttatttggcagattcctcacttc
ttagcattggctattaagaaaactgaggattacagagctgcaaatattccgatgcttcct
gtcgtatacggatttgaagtgacaaaaagacaaattattgtgtgggttgcgtgcctgatg
ccgcttccgtttttccttggtagcctgggtcttccgattgtcattctcggcttgctgtta
aatatcggctggctgattcttggcttaatgggattccgctccaagaatatcatgaagtgg
gcaacgcagatgttcgtttactcgcttaactacatgacaatctatttcgttgccatggtt
gtcttgacgcttttctaa

DBGET integrated database retrieval system