KEGG   Bacillus subtilis subsp. subtilis 168: BSU14440
Entry
BSU14440          CDS       T00010                                 

Gene name
ykpB
Definition
(RefSeq) oxidoreductase
  KO
K00077  2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU14440 (ykpB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     BSU14440 (ykpB)
SSDB
Motif
Pfam: ApbA ApbA_C F420_oxidored TrkA_N Epimerase
Other DBs
NCBI-GeneID: 938752
NCBI-ProteinID: NP_389327
Pasteur: BG13271
BSORF: BG13271
UniProt: O31717 A0A6M3ZAI6
Position
1514052..1514963
AA seq 303 aa
MKFLVVGAGGVGGYIGGRLSEKGNDVTFLVRQKRAEQLKKTGLVIHSEKGNVSFQPELIS
AGETGQFDVVIIASKAYSLGQVIEDVKPFIHQESVIIPFLNGYRHYEQLFAAFSKEQVLG
GLCFIESALDNKGEIHHTSASHRFVFGEWNGERTERIRALEEAFSGVKAEVIISGHIEKD
IWKKYLFIAAQAGITTLFQRPLGPILATEAGRHTAQTLIGEICTVLRKEGVPADPALEEE
SFRTMTSMSYHMKSSMLRDMENGQTTEGDHLHGFLIEKAKRLSLAAPVLETVYANLQMYE
AEK
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaaatttttggttgtcggagcaggtggagtaggcgggtatattggcggacggctttcg
gagaaaggaaatgatgtgacatttctcgtgcgccaaaaacgagctgagcagcttaaaaaa
accgggcttgtcatccatagtgaaaaagggaatgtatcatttcagcccgaactaatcagt
gccggagaaacagggcaatttgatgtcgttatcattgcttctaaagcatactcgcttggt
caagtgatagaggatgtcaaaccatttatccatcaagaatctgtcattatccctttttta
aatgggtaccgccactatgagcagctatttgcggcattttcaaaagaacaggtgctgggc
ggcctgtgttttatagaaagtgctttagacaacaaaggagaaattcatcatacgagcgca
tcgcatcgttttgtatttggagaatggaacggcgagcgtacggagcggataagagcgctt
gaagaggcattttcaggtgtgaaggctgaagtcatcattagcgggcatatcgagaaggac
atttggaaaaagtatctctttattgcagcgcaagcggggatcacaacgttatttcaacga
ccgcttggcccaatcctcgccacagaagccggacgtcacacggcccaaactcttattggg
gaaatttgcactgttttacgaaaagaaggtgttccggctgatccggctcttgaggaagag
agctttcgtacgatgaccagcatgtcttaccatatgaagtcctccatgcttcgggatatg
gaaaacggccaaacgacagaaggcgaccacctgcatggatttttgattgaaaaagcaaaa
cgtttatctctcgctgcaccagtattagaaaccgtttatgcgaatctgcaaatgtatgaa
gcagaaaaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU15110
Entry
BSU15110          CDS       T00010                                 

Gene name
ylbQ
Definition
(RefSeq) 2-dehydropantoate 2-reductase
  KO
K00077  2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU15110 (ylbQ)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     BSU15110 (ylbQ)
SSDB
Motif
Pfam: ApbA ApbA_C DAO F420_oxidored NAD_binding_8 TrkA_N FAD_binding_3 UDPG_MGDP_dh_N Pyr_redox Sacchrp_dh_NADP Pyr_redox_2 NAD_binding_7 NAD_binding_2
Other DBs
NCBI-GeneID: 936782
NCBI-ProteinID: NP_389394
Pasteur: BG13369
BSORF: BG13369
UniProt: O34661 A0A6M4JG43
Structure
PDB: 
3EGO

Position
1577409..1578305
AA seq 298 aa
MKIGIIGGGSVGLLCAYYLSLYHDVTVVTRRQEQAAAIQSEGIRLYKGGEEFRADCSADT
SINSDFDLLVVTVKQHQLQSVFSSLERIGKTNILFLQNGMGHIHDLKDWHVGHSIYVGIV
EHGAVRKSDTAVDHTGLGAIKWSAFDDAEPDRLNILFQHNHSDFPIYYETDWYRLLTGKL
IVNACINPLTALLQVKNGELLTTPAYLAFMKLVFQEACRILKLENEEKAWERVQAVCGQT
KENRSSMLVDVIGGRQTEADAIIGYLLKEASLQGLDAVHLEFLYGSIKALERNTNKVF
NT seq 897 nt   +upstreamnt  +downstreamnt
atgaaaattggaattatcggcggaggctccgttggtcttttatgcgcctattatttgtca
ctttatcacgacgtgactgttgtgacgaggcggcaagaacaggctgcggccattcagtct
gaaggaatccggctttataaaggcggggaggaattcagggctgattgcagtgcggacacg
agtatcaattcggactttgacctgcttgtcgtgacagtgaagcagcatcagcttcaatct
gttttttcgtcgcttgaacgaatcgggaagacgaatatattatttttgcaaaacggcatg
gggcatatccacgacctaaaagactggcacgttggccattccatttatgttggaatcgtt
gagcacggagctgtaagaaaatcggatacagctgttgatcatacaggcctaggtgcgata
aaatggagcgcgttcgacgatgctgaaccagaccggctgaacatcttgtttcagcataac
cattcggattttccgatttattatgagacggattggtaccgtctgctgacgggcaagctg
attgtaaatgcgtgtattaatcctttaactgcgttattgcaagtgaaaaatggagaactg
ctgacaacgccagcttatctggcttttatgaagctggtatttcaggaggcatgccgcatt
ttaaaacttgaaaatgaagaaaaggcttgggagcgggttcaggccgtttgtgggcaaacg
aaagagaatcgttcatcaatgctggttgacgtcattggaggccggcagacggaagctgac
gccattatcggatacttattgaaggaagcaagtcttcaaggtcttgatgccgtccaccta
gagtttttatatggcagcatcaaagcattggagcgaaatacaaacaaagtcttttga

DBGET integrated database retrieval system