KEGG   Bacillus subtilis subsp. subtilis 168: BSU14870
Entry
BSU14870          CDS       T00010                                 

Symbol
ctaA
Name
(RefSeq) heme A synthase
  KO
K02259  heme a synthase [EC:1.17.99.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU14870 (ctaA)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU14870 (ctaA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU14870 (ctaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU14870 (ctaA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With unknown physiological acceptors
    1.17.99.9  heme a synthase
     BSU14870 (ctaA)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    BSU14870 (ctaA)
SSDB
Motif
Pfam: COX15-CtaA
Other DBs
NCBI-GeneID: 937030
NCBI-ProteinID: NP_389370
Pasteur: BG10213
BSORF: BG10213
UniProt: P12946 A0A6M3ZDZ2
Structure
PDB: 
6A2J 6IED

Position
complement(1558034..1558954)
AA seq 306 aa
MNKALKALGVLTTFVMLIVLIGGALVTKTGSGQGCGRQWPLCHGRFFPELNPASIIEWSH
RFASGISIILVLSLAFWSWRKITPIFRETTFLAIMSIIFLFLQALLGALAVVFGSNALIM
ALHFGISLISFASVLILTLLIFEADKSVRTLVKPLQIGKKMQFHMIGILIYSYIVVYTGA
YVRHTESSLACPNVPLCSPLNNGLPTQFHEWVQMGHRAAALLLFVWIIVAAVHAITSYKD
QKQIFWGWISCLIFITLQALSGIMIVYSELALGFALAHSFFIACLFGVLCYFLLLIARFR
YESRQS
NT seq 921 nt   +upstreamnt  +downstreamnt
atgaataaagcattaaaagctctcggtgttctgacgacatttgtcatgctaattgtttta
atcgggggtgccctcgttacaaaaacaggttccggccaaggatgcggcagacagtggccg
ctgtgtcacggccgttttttccctgaactgaatccggcttcaattattgaatggagccac
cgattcgcaagcggaatctctattatccttgtgctaagccttgcgttttggtcatggaga
aaaatcacgccgatttttcgtgaaacaacgtttctcgcgatcatgtcaattatcttttta
tttcttcaggcattgcttggcgcattggctgtcgtattcggttcgaacgcgctgattatg
gcgcttcacttcggcatctcattaatttcttttgcttcagtgcttattttaacattgctc
atatttgaagctgataaatcagtcagaacactggttaagccgcttcaaatcggcaaaaag
atgcaatttcacatgataggaattttaatatattcctatatcgttgtgtatacaggcgca
tatgtaagacacactgaatcaagtctggcatgtcctaatgtgccgctgtgcagcccgctg
aacaatggacttccgacccaattccatgaatgggtgcaaatgggccacagagcagcagcc
ttacttttatttgtatggattattgttgccgctgttcatgctattacttcctataaagat
caaaaacagatcttttggggatggatctcatgtcttattttcattacattacaggcactg
tccggtattatgatcgtatactctgaactggctctgggctttgcacttgcccactcgttc
tttattgcctgtctgtttggcgttctatgctacttcttattattgattgctcgtttccgt
tatgaatccaggcaatcataa

DBGET integrated database retrieval system