KEGG   Bacillus subtilis subsp. subtilis 168: BSU15430
Entry
BSU15430          CDS       T00010                                 

Symbol
ileS
Name
(RefSeq) isoleucine--tRNA ligase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU15430 (ileS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU15430 (ileS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU15430 (ileS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     BSU15430 (ileS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BSU15430 (ileS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BSU15430 (ileS)
 Prokaryotic type
   Other AARSs
    BSU15430 (ileS)
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e tRNA-synt_1_2 tRNA-synt_1f HA1
Other DBs
NCBI-GeneID: 940119
NCBI-ProteinID: NP_389426
Pasteur: BG11792
BSORF: BG11792
UniProt: Q45477 A0A6M3ZAS7
Position
1613357..1616122
AA seq 921 aa
MDFKDTLLMPKTDFPMRGNLPNREPDIQKKWEEEDIYRLVQERTKDRPKFVLHDGPPYAN
GDIHMGHALNKILKDFIVRYKSMSGYNAPYVPGWDTHGLPIETALTKNKKVNRKEMSVAE
FRKLCEEYAWKQIEGQREQFKRLGVRGDWENPYVTLKPEYEAQQIRVFGEMAKRGYIYKG
LKPVNWSPSSESALAEAEIEYQDKRSASIYVAFGVKDGKGVLENGERIIIWTTTPWTIPA
NLGISVHPDLEYSVIAVGEDRFVVASALVENVASACGFDQYEVTRTVKGKDLENIIAEHP
LYGRDSLVMLGEHVTTDAGTGCVHTAPGHGEDDFIIGQKYGLDVLCPVDEKGVMTSEAPG
FEGMFYDDANKAITQQLDEKGALVKLEFITHSYPHDWRTKKPTIFRATAQWFASIKDFRS
DLLDAIKETKWVPEWGEQRLHNMVRDRGDWCISRQRAWGVPIPVFYAENGEPVITDETIE
HVSELFRQHGSNIWFEKEAKDLLPEGFTHPGSPNGTFTKEQDIMDVWFDSGSSHQAVLEE
RDDLVRPADLYLEGSDQYRGWFNSSLSTAVAVTGKAPYKGVLSHGFALDGEGRKMSKSIG
NVVVPAKVMKQLGADILRLWVSSVDYQADVRVSDAILKQVAEVYRKIRNTFRFLHGNLFD
FDPKTNAVAVEDLREVDQYMLIKLNKLIDKVKKAYDEYEFAVVYHSIHNFCTIELSSFYL
DFAKDIVYIEHADHPDRRSMQTVFYETLLALVKLSAPILPHTADELWSHLTFVEEQSVQL
TDMPETITVPNSEATEEKFDRFMALRDDVLKALETARNEKIIGKSLEANLKLYPNKENKE
LLASIKENLSQLFIVSELTISEENEAPNDAQSFATGKIAVEKAEGEMCERSRVISKDVGA
NPKYPTLSLRNAEIVEKYYQK
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggattttaaagacacgctcttaatgccgaaaacagatttcccgatgcgtggaaatttg
ccaaaccgtgagcctgacattcaaaaaaaatgggaggaagaagatatctaccgtcttgtt
caggaacggacgaaagaccgcccgaaatttgttttacatgacggacctccgtatgcaaac
ggcgacatccatatgggccatgcacttaacaagattttgaaagacttcattgtccgctat
aaatcaatgagcggctacaacgcaccgtatgtgccgggctgggatacacacggattgcca
attgaaacagctctgacaaaaaacaaaaaggtcaaccgcaaagaaatgtcagtagcggaa
ttccgcaaactatgcgaagagtacgcttggaagcaaatcgagggacagcgtgagcaattc
aaacgtcttggtgtccgcggtgactgggaaaacccatatgtgacattaaaaccggaatac
gaagcgcagcaaatccgcgtatttggtgaaatggcaaaacgaggctacatttacaaaggc
cttaaaccggttaactggtcaccttcaagtgagtctgctctggctgaagccgagatcgaa
tatcaagataaacgttcagcatctatttacgtcgcttttggtgtaaaagacggaaaaggc
gttcttgaaaacggcgagcgcatcatcatttggacaacaacgccgtggacaattccggcg
aacctcggaatctcagtgcaccctgatcttgagtacagcgtgattgcagtaggtgaagac
cgctttgttgtagcaagtgccttagtcgaaaatgttgcatcggcatgcggatttgatcag
tatgaagtgacaagaacggtcaaagggaaagaccttgagaacattatcgctgaacacccg
ctatatggcagagactctctcgttatgcttggtgaacacgtaacaactgatgccggaaca
ggctgtgttcatacagcgcctggacatggggaagatgactttatcatcggccaaaaatac
ggtttagatgtgctttgcccggtcgatgaaaaaggtgtaatgacaagcgaagctcctggc
tttgaaggcatgttctatgatgatgcaaacaaagcgatcacacagcagcttgatgaaaaa
ggcgcacttgtgaagcttgaattcattactcattcttatccgcatgattggagaacaaaa
aaaccaaccattttcagagcaacagcgcaatggtttgcgtctattaaagatttcagatca
gacctgctggatgccattaaagaaaccaaatgggttcctgaatggggcgagcagcgtttg
cacaacatggttcgggaccgcggagactggtgtatttccagacagcgtgcgtggggtgtg
ccgattccggtattttacgctgaaaacggagaaccggttattacagatgaaaccattgaa
catgtttctgaattgttcagacagcatggatcaaacatttggtttgaaaaagaagcaaag
gatcttcttccggaaggctttacgcatcctggcagcccgaacggcacatttacaaaagaa
caggatatcatggatgtttggtttgattcaggctcttcacatcaagcagtgcttgaagaa
cgtgatgacctcgttcgcccggctgatctatacctagagggatctgaccaatatcgcggc
tggtttaactcttctctttctacagcagtagccgtaacagggaaagcgccgtataaaggt
gtgctcagccatgggttcgcactggatggagaaggacgtaagatgagtaaatcaatcggt
aacgttgttgttccggctaaagtcatgaaacagcttggtgccgacatcttaagattatgg
gtatcttcagtggattatcaggcggacgttcgcgtgtctgacgccattctgaagcaggtt
gcggaagtatatcgtaaaatccgcaacacgttccgtttccttcacggcaaccttttcgat
tttgatccaaaaacaaatgcggtggctgtcgaagatcttcgcgaagtggatcagtatatg
ctgattaagctgaacaagctgattgataaagtgaaaaaagcgtatgatgagtacgaattt
gcggttgtgtatcacagcattcataatttctgcacaatcgaattgagctcattctacctt
gattttgcaaaagatattgtctacatcgagcatgcggatcatccggatagacgcagcatg
cagacagtattctacgaaacgcttcttgcattagtgaagctttcagcgcctatccttcca
catacggcagacgaattgtggtctcatttaacatttgttgaagagcagagcgttcagttg
accgatatgccggaaacaatcacggttccaaacagtgaagcgactgaagaaaaatttgac
cgctttatggctcttcgtgatgacgtgttaaaagcattagaaactgcgcgaaatgaaaaa
attatcggtaaatctttggaagcaaacctgaaattgtatccaaacaaagaaaacaaggag
ctcttggcttccataaaagaaaacctttctcagctgtttattgtgtctgaactgacaatc
agcgaagaaaatgaagcgccgaacgatgcgcaaagctttgcgacgggtaaaatcgctgtc
gagaaagcggaaggcgaaatgtgtgagagatctcgtgtgatttcaaaagatgtaggggca
aatccgaaatatcctacactttcattacgcaacgctgaaatcgttgaaaaatactatcaa
aaataa

DBGET integrated database retrieval system