KEGG   Bacillus subtilis subsp. subtilis 168: BSU15710
Entry
BSU15710          CDS       T00010                                 

Symbol
priA
Name
(RefSeq) primosomal protein N'
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BSU15710 (priA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU15710 (priA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     BSU15710 (priA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BSU15710 (priA)
SSDB
Motif
Pfam: PriA_3primeBD PriA_C ResIII DEAD PriA_CRR Helicase_C PIF1 zinc-ribbons_6 ATPase_2 TrwB_AAD_bind AAA_30 T2SSE AAA_19 YicC_N
Other DBs
NCBI-GeneID: 938122
NCBI-ProteinID: NP_389453
Pasteur: BG11963
BSORF: BG11963
UniProt: P94461 A0A6M3ZBA6
Position
1644068..1646485
AA seq 805 aa
MNFAEVIVDVSTKNIDRPFDYKIPDHLKGMIKTGMRVIVPFGPRKIQGFVTAVKEASDLS
GKSVKEVEDLLDLTPVLTEELMILSSWLSDKTLSFKITALQAMLPAALKAKYEKELKIAH
GADLPPQVERLFSETKTLLYSDIPDHETLKLIQRHVQKGDIDVTYKVAQKTNKKMVRHIQ
ANASKEELAKQAEGLSRQAAKQQAILHFLISEPEGVKIPAAELCKKTDTSSATIKTLIQK
GLLKESYEEVYRDPYQDKMFKKTEPLPLTDEQRAAFEPIRETLDSDEHKVFLLHGVTGSG
KTEIYLQSIEKVLAKGKEAIVLVPEISLTPQMVNRFKGRFGSQVAVMHSGLSTGEKYDEW
RKIHRKEVRLVVGARSAIFAPFENLGMIIIDEEHESSYKQEEMPRYHAKEVAIKRAEHHS
CPVVLGSATPTLESYARAQKGVYELLSLKHRVNHRVMPEVSLVDMREELRNGNRSMFSVE
LMEKLEETIAKGEQAVLFLNKRGYSSFVMCRDCGYVPQCPHCDISMTYHRYGQRLKCHYC
GHEEPVPHTCPECASEHIRFFGTGTQRVEEELTKVLPSARVIRMDVDTTSRKGAHEKLLS
AFGEGKADILLGTQMIAKGLDFPNVTLVGVLSADTTLHIPDFRSAEKTFQLLTQVSGRAG
RHEKPGHVIIQTYTPSHYSIQLTKTHDYETFYQHEMAHRREQSYPPYYYLALVTVSHEEV
AKAAVTAEKIAHFLKANCGADTKILGPSASPIARIKDRYRYQCVIKYKQETQLSALLKKI
LEHYKREIEQKHVMISIDMNPYMMM
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgaattttgcagaagtcatcgttgatgtcagcaccaaaaatatagacaggccttttgat
tataaaatcccagaccatctgaagggcatgatcaaaacggggatgcgggtcattgttccg
tttggcccccgtaagattcaagggtttgtgacagcagtcaaagaagcatctgacctatcg
ggaaaatctgtcaaggaagtagaggatttattagatcttacacctgttctgacagaggag
cttatgattctgtcatcatggctgtcagacaaaacgctgtcttttaaaataacggcgctt
caagcaatgctgcctgccgccttaaaggcgaaatatgaaaaagaattaaaaattgcacac
ggagccgatcttccgccgcaagtggaacggctgttttctgaaacaaagacgctgctgtat
tcagatatacccgatcatgagacgctgaaactgattcaaaggcatgttcaaaaaggggac
attgacgtgacgtataaagtcgcgcaaaaaaccaataaaaaaatggtcaggcatattcag
gcaaatgcgagtaaagaagagcttgctaagcaggctgagggattgtcccgccaagcagca
aaacagcaggcgattcttcactttctcatctctgagccggaaggtgtgaaaattcctgcg
gcggaattgtgcaaaaaaacggacacgagctctgcaaccatcaaaacccttatccaaaaa
gggcttttgaaggaaagctatgaagaggtttacagagatccctatcaggacaaaatgttc
aaaaaaacagagcccctgccgctgacagacgaacagagggctgccttcgagcccatacgc
gagacattggacagcgatgagcataaagtgttcctccttcacggcgtgacaggaagcgga
aaaaccgaaatttatctgcaatcaattgaaaaagtactggcgaaaggaaaagaagccatc
gtcctcgtaccggaaatatcgctgacgccgcaaatggtcaaccgcttcaagggccgcttc
ggctcccaggtggcagtcatgcacagcggtttatccacaggagaaaaatatgacgagtgg
cgtaaaatccaccggaaggaagtacggcttgtcgtcggtgccagatccgccatttttgct
ccgtttgaaaatctcggaatgataatcatcgatgaagagcacgagtcttcctataaacag
gaagaaatgccgcgctatcatgcgaaagaggtggcaatcaagcgggctgagcatcacagc
tgcccggttgtattagggagtgctacgccgacattagaatcatatgctagagcgcaaaag
ggcgtatacgagcttctttcactgaagcaccgtgttaaccatcgggtgatgcccgaggtt
tcgcttgtcgatatgagagaggagcttagaaacggcaatcgctcgatgttttcagttgaa
ttgatggaaaagcttgaagaaacgattgccaagggtgagcaggcggtgctgtttttaaat
aagaggggctactcttcctttgtgatgtgcagggattgcggctatgtcccgcaatgcccg
cactgcgacatttccatgacgtatcatcgttacggccaaaggctgaaatgccattattgc
ggacatgaagagcctgttccgcacacttgtcctgaatgcgcaagcgagcatatccgcttt
ttcggaacgggaacacagcgagtggaggaagagctgacaaaagtgctgccaagtgcgaga
gtgattcggatggatgttgacacgacatcacggaaaggcgcccatgaaaaattactgtca
gctttcggagaaggaaaagcggatattcttctcggaacgcaaatgatcgcgaaagggctt
gattttccgaatgtcacgcttgtcggagtgttaagtgctgatacaacacttcatattcct
gatttcagatcggctgaaaaaacatttcagctgttaacgcaagtcagcggccgggcaggc
aggcatgaaaagcccggccatgtcatcattcaaacgtatacaccgtctcattacagtatc
cagctgacgaaaacacacgattatgaaacgttctatcagcatgaaatggcgcacaggaga
gagcaatcctatccgccatactactatttggctcttgtgactgtttctcatgaggaagtg
gcgaaagcagcggttacagctgaaaaaatcgctcattttttgaaagcaaactgcggagct
gacacgaaaattctcggaccaagcgcgtcgccgatagccaggatcaaagatagatatcgc
tatcaatgcgtgataaaatacaaacaggaaacccagttatccgctttattgaagaagata
ctggaacattataaacgcgaaattgaacaaaaacatgtaatgatttcaattgatatgaat
ccttatatgatgatgtaa

DBGET integrated database retrieval system