KEGG   Bacillus subtilis subsp. subtilis 168: BSU15950
Entry
BSU15950          CDS       T00010                                 

Gene name
ftsY
Definition
(RefSeq) signal recognition particle receptor FtsY
  KO
K03110  fused signal recognition particle receptor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
bsu03060  Protein export
bsu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU15950 (ftsY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU15950 (ftsY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU15950 (ftsY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU15950 (ftsY)
Secretion system [BR:bsu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BSU15950 (ftsY)
SSDB
Motif
Pfam: SRP54 SRP54_N AAA_30 MeaB AAA_16 Zeta_toxin AAA_22 NTPase_1 AAA_17 APS_kinase ABC_tran Thymidylate_kin RsgA_GTPase Vta1 AAA_5 AAA_33 DUF2075 MMR_HSR1 AAA NACHT DUF1002 CbiA AAA_24 AAA_7 SMC_ScpA ApoLp-III YqeC AAA_18 KdpD AAA_31 TrwB_AAD_bind MobB PIF1 Mei5 Myb_DNA-bind_4 AAA_14 CHAD AAA_28 SPT16 AAA_19 Sec23_helical ArsA_ATPase Prominin cobW AAA_32 YtxH
Other DBs
NCBI-GeneID: 936921
NCBI-ProteinID: NP_389477
Pasteur: BG11539
BSORF: BG11539
UniProt: P51835 A0A6M4JI60
Position
1670140..1671129
AA seq 329 aa
MSFFKKLKEKITKQTDSVSEKFKDGLEKTRNSFQNKVNDLVSRYRKVDEDFFEELEEVLI
SADVGFTTVMELIDELKKEVKRRNIQDPKEVQSVISEKLVEIYNSGDEQISELNIQDGRL
NVILLVGVNGVGKTTTIGKLAHKMKQEGKSVVLAAGDTFRAGAIEQLEVWGERTGVPVIK
QTAGSDPAAVIYDAVHAAKARNADVLICDTAGRLQNKVNLMKELEKVKRVIEREVPEAPH
EVLLALDATTGQNAMAQAKEFSKATNVTGIALTKLDGTAKGGIVLAIRNELHIPVKLVGL
GEKVDDLQEFDPESYVYGLFSDLVEKADD
NT seq 990 nt   +upstreamnt  +downstreamnt
atgagcttttttaaaaaattaaaagagaaaatcacaaaacagacagattccgtatctgaa
aagtttaaggatggccttgaaaaaacaagaaactcctttcaaaacaaagtgaatgatctt
gtatcccgttaccgtaaagtggatgaggatttcttcgaagagcttgaagaggttcttatc
agcgcggatgtcggttttacaaccgttatggaattaatagatgagctgaaaaaagaagtc
aaacgcagaaatattcaagatccaaaggaagtccagtcagtgatttctgagaaactggtc
gagatttataacagcggagatgagcaaatttcagaactgaacatccaggatgggcgttta
aacgtaatccttctggtaggtgtaaacggcgtcgggaaaacaacaacgatcggaaagctt
gctcataaaatgaaacaagaaggaaaatctgttgtacttgccgccggagacacttttaga
gcgggagccattgaacagctggaagtatggggagagcgtacaggagtgcctgtcattaag
cagacggcaggaagcgatccggcggctgtcatctacgatgctgttcatgctgcgaaagca
agaaatgccgatgtattaatttgtgatacggcagggcgtctccaaaacaaagtaaatctc
atgaaagagcttgaaaaagtaaaacgtgttatcgaaagagaagttcctgaagctccgcat
gaggtgctgcttgcccttgatgccacgaccggccaaaatgcaatggctcaggcaaaagaa
ttctctaaagcaacaaatgttaccggcattgctttaacgaagcttgacggtacggcaaaa
ggcggtatcgtccttgcgattcgcaacgagcttcacatcccggttaaactagtcggttta
ggagaaaaagttgatgaccttcaggaatttgatccagaatcctatgtgtacggactcttt
tcagatttagtggaaaaagccgacgattaa

DBGET integrated database retrieval system