KEGG   Bacillus subtilis subsp. subtilis 168: BSU16040
Entry
BSU16040          CDS       T00010                                 

Symbol
rplS
Name
(RefSeq) 50S ribosomal protein L19
  KO
K02884  large subunit ribosomal protein L19
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU16040 (rplS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU16040 (rplS)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU16040 (rplS)
  Bacteria
    BSU16040 (rplS)
SSDB
Motif
Pfam: Ribosomal_L19
Other DBs
NCBI-GeneID: 937598
NCBI-ProteinID: NP_389486
Pasteur: BG12667
BSORF: BG12667
UniProt: O31742 A0A6M4JGB2
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
1676033..1676389
AA seq 118 aa
MKTMQKLIEDITKEQLRTDLPAFRPGDTLRVHVKVVEGNRERIQIFEGVVIKRRGGGISE
TFTVRKISYGVGVERTFPVHTPKIAKIEVVRYGKVRRAKLYYLRELRGKAARIKEIRR
NT seq 357 nt   +upstreamnt  +downstreamnt
ttgaaaacgatgcaaaaactaattgaagatatcacaaaagaacagcttcgtactgatctt
cctgcgttccgtcctggtgacactttacgtgtacacgttaaagttgttgagggtaaccgt
gagcgtatccagatctttgaaggtgttgtgattaagcgtcgtggtggtggaatcagcgaa
acgttcacagttcgtaagatttcttacggtgttggcgttgaacgtactttcccagtacac
acaccaaaaatcgcgaaaatcgaagttgtacgttacggtaaagtacgccgtgctaaactt
tactacctgcgtgaacttcgcggaaaagcggctcgtattaaagagatcagacgataa

DBGET integrated database retrieval system