KEGG   Bacillus subtilis subsp. subtilis 168: BSU16190
Entry
BSU16190          CDS       T00010                                 

Symbol
flgC
Name
(RefSeq) flagellar basal-body rod protein FlgC
  KO
K02388  flagellar basal-body rod protein FlgC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16190 (flgC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16190 (flgC)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod and hook
    BSU16190 (flgC)
SSDB
Motif
Pfam: Flg_bb_rod Flg_bbr_C
Other DBs
NCBI-GeneID: 938646
NCBI-ProteinID: NP_389501
Pasteur: BG10238
BSORF: BG10238
UniProt: P24501 A0A6M3ZIA9
Position
1691667..1692119
AA seq 150 aa
MTAFHSLNVSASALTAQRVRMDVVSSNLANMDTTRAKQVNGEWVPYRRKMVSLQSKGESF
SSILNSQMSGSGNAGNGVKVSKITEDDSDFNLVYDPTDPDANAEGYVQKPNVDPLKEMVD
LVSSTRSYEANVTAMNATKGMLMKALEIGK
NT seq 453 nt   +upstreamnt  +downstreamnt
atgacagcttttcatagcttaaatgtttcagcatcggctttaacagctcagcgagtcaga
atggacgttgtatcatctaacttagcaaatatggatacgacaagagctaagcaggtgaat
ggagagtgggtgccttacagaagaaaaatggtttcccttcagtcaaaaggtgaatcgttc
tcttccattctcaattctcaaatgagcggaagcgggaatgctggaaacggtgtgaaggtt
tcaaaaattacggaggatgattcggattttaatcttgtctatgatccgacagaccctgat
gcaaacgctgaaggatatgtacaaaagcctaatgttgatccattaaaggaaatggttgat
cttgtcagcagcactagatcatacgaggcgaatgtcacggcgatgaatgccacaaaggga
atgctgatgaaggcgttagaaatcggaaagtag

DBGET integrated database retrieval system