KEGG   Bacillus subtilis subsp. subtilis 168: BSU16210
Entry
BSU16210          CDS       T00010                                 

Symbol
fliF
Name
(RefSeq) flagellar M-ring protein
  KO
K02409  flagellar M-ring protein FliF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16210 (fliF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU16210 (fliF)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16210 (fliF)
Secretion system [BR:bsu02044]
 Type III secretion system
  Flagellar export apparatus
   BSU16210 (fliF)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   M, S, P and L rings
    BSU16210 (fliF)
SSDB
Motif
Pfam: YscJ_FliF YscJ_FliF_C LRR19-TM DUF4064 DUF2207 MpPF26 EphA2_TM DUF3671 DUF2970
Other DBs
NCBI-GeneID: 936677
NCBI-ProteinID: NP_389503
Pasteur: BG10240
BSORF: BG10240
UniProt: P23447 A0A6M4JMY9
Position
1692496..1694106
AA seq 536 aa
MNRTLMQMKNKTSEFWKNRSKLQKILMVSALAAIIIIGIIISVFASNSKMAPLYKDLSAE
EAGQIKEELDAKKVPNELSNGGTVISVPEDQVDSLKVQMAAEGLPKTGSIDYSFFGQNAG
FGLTDNEFDMVKVKATQTELSNLINEMDGIKNSKVMINLPKDAVFVGEEQSAASASIVLQ
IQPGYTLDQSQINGLYHLVSKSVPNLKEDNIVIMDQNSTYYDKSDSDAGSYADSYSSQQG
IKSQVEKDIQKHVQSLLGTMMGQDKVVVSVTADIDFTKENRTEDIVEPVDKENMEGIAVS
AEKVSETYQGDGAANGGTAGTGEEDVTNYKADGENTESGNYEKNSNKINYEVNRIHKEIA
ESPYKVRDLGIQVMVEPPDAKNTASLSTERQDDIQKILSTVVRTSLDKDETQNQNLSDAD
INNKIVVSVQPFDGKVNLDTNTEESSGIPLWAYIVGGVLIAAIIVLIIMLIRKKRAQEDE
FEEYEYEVPQEPINLPDINEEENETAESVRRKQLEKMAKDKPEDFAKLLRSWLAED
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgaatcgtactctaatgcaaatgaaaaacaaaacgagtgagttttggaaaaatagatct
aaattacaaaagattttaatggttagtgctttagcggcaattattattattggaattatt
attagtgtttttgcttcaaattctaaaatggcgccgctgtacaaagatttgtctgccgaa
gaagcaggacaaatcaaagaagaattggatgcaaaaaaagtgccaaacgaactttcgaat
ggcggtacagtgattagtgttccggaggatcaggttgattctttgaaagtgcagatggct
gcagaaggacttcctaaaacgggatcaattgattattcgttttttggacagaatgccggc
tttggtttgacagacaatgagtttgatatggtgaaagtgaaagctacacagacagaactg
tcaaacttgatcaatgaaatggacggtattaaaaattcaaaagtaatgattaatctcccg
aaagacgctgtgtttgtcggtgaagagcaatctgcagcatctgcatcaatcgttttgcag
attcaaccgggttatacacttgatcaaagccaaatcaacggattatatcatctggtatct
aaaagcgtgccaaacctaaaagaagataacatcgtcatcatggaccaaaattctacatac
tacgacaaatcagacagcgatgcagggtcctacgcggatagttattcttctcagcaagga
attaagtctcaagttgaaaaagacattcaaaaacatgtacagtcactgctgggtacgatg
atgggccaagataaagtcgttgtctccgttacagcagacattgatttcacaaaagaaaat
cggacagaagacattgtcgaacctgtggataaagaaaacatggaaggcattgcagtcagc
gctgaaaaggtatctgaaacatatcagggcgacggtgcagccaacggcggaactgccgga
accggcgaggaagatgttacaaattataaggctgacggtgaaaataccgaaagcgggaac
tacgaaaaaaacagcaacaaaatcaattacgaggttaaccgaattcataaagaaatcgct
gaaagtccttataaggtcagagatttagggattcaagtaatggtagagccgcctgatgcc
aaaaacactgcgtcgctatcaactgaaagacaggatgatatacaaaaaatcctttcaact
gtagtcagaacatctttggataaagatgaaacgcaaaatcagaatttatctgatgctgat
atcaataataagattgttgtttccgttcagccattcgacggaaaagtcaatttggataca
aatacggaagaatcctcaggtatcccgctgtgggcatatattgtaggcggtgttttaatc
gcagcgatcattgttctgatcattatgcttatcagaaagaaacgggcgcaagaggatgaa
tttgaggaatatgagtatgaggttcctcaagaaccaatcaatttgcctgatatcaacgaa
gaggaaaatgaaacagcggaatcagtcagacgaaaacagcttgaaaagatggcgaaagac
aagccggaagattttgcaaaactgctgagaagctggctggccgaggattag

DBGET integrated database retrieval system