KEGG   Bacillus subtilis subsp. subtilis 168: BSU16220
Entry
BSU16220          CDS       T00010                                 

Symbol
fliG
Name
(RefSeq) flagellar motor switch protein FliG
  KO
K02410  flagellar motor switch protein FliG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02030  Bacterial chemotaxis
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU16220 (fliG)
   02040 Flagellar assembly
    BSU16220 (fliG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16220 (fliG)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   C ring
    BSU16220 (fliG)
SSDB
Motif
Pfam: FliG_N FliG_C FliG_M MgtE_N His_biosynth ECH_2 TFA2_Winged_2 NuDC TRAF_BIRC3_bd
Other DBs
NCBI-GeneID: 937577
NCBI-ProteinID: NP_389504
Pasteur: BG10241
BSORF: BG10241
UniProt: P23448 A0A6M3ZG40
Position
1694119..1695135
AA seq 338 aa
MARRDQDKLTGKQKAAILMISLGLDVSASVYKHLTDEEIERLTLEISGVRSVDHQKKDEI
IEEFHNIAIAQDYISQGGLSYARQVLEKALGEDKAENILNRLTSSLQVKPFDFARKAEPE
QILNFIQQEHPQTMALILSYLDPVQAGQILSELNPEVQAEVARRIAVMDRTSPEIINEVE
RILEQKLSSAFTQDYTQTGGIEAVVEVLNGVDRGTEKTILDSLEIQDPDLAEEIKKRMFV
FEDIVTLDNRAIQRVIRDVENDDLLLSLKVASEEVKEIVFNNMSQRMVETFKEEMEFMGP
VRLKDVEEAQSRIVSIVRKLEEAGEIVIARGGGDDIIV
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggcgagacgtgatcaagataagcttacaggaaaacaaaaagcagccattctcatgatt
tccttggggttagatgtgtcagcttctgtctataagcacttaaccgatgaagaaattgaa
aggcttactctggaaatatcaggtgttcgaagcgtcgatcatcaaaaaaaggatgaaatc
atagaagaatttcataatatagccattgcgcaagattatatttctcaaggcggtttaagc
tatgcaagacaagttctggaaaaggcgcttggagaggataaggcggagaacattctaaac
aggctgacttcttctttgcaggttaaaccatttgattttgccagaaaagcggagccagaa
caaattttgaattttatccagcaagagcatccgcagacgatggcgttaatcttgtcttat
ttagatccagtgcaggccgggcaaattttatccgagctgaaccctgaagtgcaggctgag
gttgcgagaagaatcgcggtcatggatagaacgtctccagaaataattaacgaggtagaa
cggattctggaacaaaaattatcttctgcatttactcaggattatacacaaacaggcgga
attgaagctgttgtggaagtgttaaacggggtagacagagggacagagaagacgatcttg
gattcattggaaattcaggatcccgatcttgctgaagagattaaaaagcggatgtttgtc
ttcgaagatattgtcacacttgataaccgtgcaattcagagagtcattcgcgatgttgag
aacgacgatttgctcctttcattaaaggttgcaagcgaggaagtcaaagaaattgtgttc
aacaatatgtcacagcgtatggttgaaaccttcaaagaagaaatggagtttatgggccct
gtacgtttgaaagatgtagaagaagctcaatcaagaattgtaagcatcgtcagaaagctt
gaagaagccggtgaaattgtaatagcaagaggcggaggggatgatattattgtctaa

DBGET integrated database retrieval system