KEGG   Bacillus subtilis subsp. subtilis 168: BSU16230
Entry
BSU16230          CDS       T00010                                 

Symbol
fliH
Name
(RefSeq) flagellar assembly protein FliH
  KO
K02411  flagellar assembly protein FliH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16230 (fliH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU16230 (fliH)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16230 (fliH)
Secretion system [BR:bsu02044]
 Type III secretion system
  Flagellar export apparatus
   BSU16230 (fliH)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    BSU16230 (fliH)
SSDB
Motif
Pfam: FliH DUF2312 4HB_MCP_1 Cnd1 Phasin
Other DBs
NCBI-GeneID: 938124
NCBI-ProteinID: NP_389505
Pasteur: BG10242
BSORF: BG10242
UniProt: P23449
Position
1695254..1695880
AA seq 208 aa
MARVKEEADRISEQANSHIENIRRQIEQEKNDWAAEKQKLIEEAKAEGFEQGVALGKAEA
MKQYAELIGQANSITEMSRKAVEDKLEDANEEIVELAVALAKKVWQQKSDDKEAFLLLVQ
QVINEVKEYDDISIYVDPYYYETIFQQKDEIQQLLYKECRLGIYADEKAQKGTCYIETPF
GRVDASVDTQLMQLKDKLLTALEAGAAE
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcccgagtgaaagaggaagctgaccggatttctgagcaggcaaacagtcatatagaa
aatattcgccgtcaaattgaacaggagaaaaacgattgggcggctgaaaaacagaagctt
attgaagaagcaaaagccgagggctttgaacaaggagtagcgctgggcaaagctgaggca
atgaaacagtatgcagaactgatcggccaagcaaacagtataactgaaatgtccagaaaa
gctgttgaggacaagcttgaagacgctaatgaagaaatcgttgagcttgccgttgcccta
gcaaaaaaagtttggcagcaaaagtctgatgataaagaggctttcctcctgcttgtacaa
caggttataaacgaagtgaaggaatatgacgatatatcaatttatgttgatccatattac
tatgagacaatctttcagcaaaaagatgaaatccagcagcttctttataaagaatgtcgg
cttggcatatatgctgatgaaaaagctcaaaaaggaacctgttatattgaaactcctttt
ggcagggtagatgcgagtgttgacacacaattgatgcaattgaaagataaacttctgaca
gcgctggaagcaggtgcagctgaatga

DBGET integrated database retrieval system