KEGG   Bacillus subtilis subsp. subtilis 168: BSU16240
Entry
BSU16240          CDS       T00010                                 

Symbol
fliI
Name
(RefSeq) flagellum-specific ATP synthase
  KO
K02412  flagellum-specific ATP synthase [EC:7.4.2.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16240 (fliI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU16240 (fliI)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16240 (fliI)
Enzymes [BR:bsu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BSU16240 (fliI)
Secretion system [BR:bsu02044]
 Type III secretion system
  Flagellar export apparatus
   BSU16240 (fliI)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    BSU16240 (fliI)
SSDB
Motif
Pfam: ATP-synt_ab T3SS_ATPase_C ATP-synt_ab_N ABC_tran RsgA_GTPase DUF87
Other DBs
NCBI-GeneID: 940136
NCBI-ProteinID: NP_389506
Pasteur: BG10243
BSORF: BG10243
UniProt: P23445 A0A6M4JGD4
Position
1695877..1697193
AA seq 438 aa
MKTQSLIDCIEMTDSYKRYGKVKRVIGLMIESKGPASSIGDLCLIYAKGQSGKVIKAEVV
GFQEENILLMPYLEAASIAPGSIVEATGESLRVKVGTGLIGQVIDAFGEPLDGKLLPKGL
SPVSTEQSPPNPMKRPPIREKMGVGVRSIDSLLTVGKGQRIGIFAGSGVGKSTLMGMIAK
QTEADLNVIALVGERGREVREFIEKDLGKEGLKRSIVVVATSDQPALMRLKAAYTATAIA
EYFRDKGQNVMFMMDSVTRVAMAQREIGLAAGEPPTTKGYTPSVFAILPRLLERTGANEH
GTITAFYTVLVDGDDMNEPIADTVRGILDGHIVLDRALANKGQFPAVNVLKSISRVMSNI
STKQHLDAANKFRELLSTYQNSEDLINIGAYKRGSSREIDEAIQFYPQLIQFLKQGTDEP
ALLEESIAALTSLTGNEE
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgaagacacagagtctgatagattgtatagaaatgacagactcgtataaacggtacgga
aaagtcaagcgggtaatcggcttgatgattgaatcaaaagggccagcaagctcaattggt
gacctgtgcctgatttatgcaaaaggacagtctgggaaagtcattaaagctgaggtagtc
ggcttccaggaagaaaatattttgcttatgccttatttagaggctgcgagcattgcacct
ggcagcattgtagaagctactggggaatcacttcgggttaaagttgggaccggactgatc
ggacaagtcatcgatgcttttggagaaccgcttgacggaaagcttctgccgaaagggctt
tcgcctgtatcaacggagcaatcaccgcctaacccgatgaaacggccgcctatccgtgaa
aagatgggtgttggagtcagatcaattgacagcttgctgacagtcggtaaaggccagcgg
attggaatttttgcaggaagcggtgtcggaaaaagcaccttaatggggatgatcgccaag
cagacagaggctgacttaaacgtcattgcacttgtcggagaacgcggacgagaggttcgg
gagtttattgaaaaagatctggggaaagaggggctgaaacgatcgattgtagtcgttgcc
acctcagaccagccagcattaatgagattgaaagcggcatatacagcgactgcaattgcc
gagtatttccgagataaaggccaaaatgtcatgtttatgatggattctgttacaagggtg
gcaatggcgcagcgagagattggactggctgcaggagagcctccgacgacaaaaggctat
acaccttcagtgttcgctattttacctcgtttactagaacgaacaggtgcaaacgagcat
ggaaccattacggcattttatacagtgttggtagatggggatgacatgaatgagccgatt
gccgataccgtacgcggaattttagacgggcatattgtgttggacagggcgcttgccaat
aaaggccagtttcctgcagttaacgtactaaaaagcatcagcagggtgatgtcaaacatt
tcaacaaaacagcatctggatgcggcaaataaattccgtgaacttttatcgacatatcaa
aattcggaagatctcattaatatcggagcttacaaaagaggatcatccagagaaattgat
gaagcgatacaattttatccgcagcttattcaatttttaaagcagggaacagacgaaccg
gctttattggaagaaagcattgctgcattaactagtttgacaggaaatgaggaataa

DBGET integrated database retrieval system