KEGG   Bacillus subtilis subsp. subtilis 168: BSU16310
Entry
BSU16310          CDS       T00010                                 

Gene name
fliM
Definition
(RefSeq) flagellar motor switch protein FliM
  KO
K02416  flagellar motor switch protein FliM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02030  Bacterial chemotaxis
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU16310 (fliM)
   02040 Flagellar assembly
    BSU16310 (fliM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16310 (fliM)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   C ring
    BSU16310 (fliM)
SSDB
Motif
Pfam: FliM FliMN_C
Other DBs
NCBI-GeneID: 939518
NCBI-ProteinID: NP_389513
Pasteur: BG10251
BSORF: BG10251
UniProt: P23453 A0A6M3ZG51
Position
1701684..1702682
AA seq 332 aa
MSGEVLSQNEIDALLSAISTGEMDAEELKKEEKEKKVKVYDFKRALRFSKDQIRSLTRIH
DNFARLLTTHFSAQLRTYIHISVSSVDQVPYEEFIRSIPNMTILNLFDVHPMEGRIMMEV
NPTIAYTMMDRVMGGIGISHNKVDSLTEIETKIISNLFENALGNYKEAWQSIADIEPEMT
EFEVNPQFVQMVSPNETVVVISLNTQIGEISGVINLCIPHIVLEPLIPKLSVHYWMQSDR
NEPKPEETKSLEKRIMTAQIPVVAELGTSELTIEEFLSLEVGDCITLDKSVTDPLTVLVG
DKPKFLGQAGRVNRKQAVQILDHDIRGEQDGE
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtcaggagaagttctctcccaaaatgaaatagatgcactgctctctgcaatatcaact
ggtgaaatggacgctgaagagctgaaaaaagaagaaaaagagaagaaagtcaaggtttat
gatttcaaacgtgcgctgcggttttctaaggatcagatccgcagtttaacgagaattcat
gacaattttgcaagacttcttaccactcatttttctgctcagctcagaacctatattcac
atatctgtcagttctgttgatcaggttccgtatgaggaatttatcagatcgattccaaac
atgacgattctgaatctatttgatgttcatccgatggaaggaagaattatgatggaggtc
aaccccacgatagcttatacgatgatggatcgagtcatgggcgggattggaatcagtcat
aacaaggttgacagtttgacagaaattgaaacaaaaatcatttctaatttatttgaaaat
gcactgggtaattataaagaagcttggcagtcaattgctgatattgaaccggaaatgact
gagtttgaagtgaatccgcaatttgttcagatggtatctcctaatgaaacagtcgtggtg
atctcgctcaatactcaaattggtgaaatcagcggtgtcattaatctctgtatcccgcat
attgtactcgagccgctcataccgaagctttcagtccactattggatgcaatcagaccga
aatgagccaaagcctgaggaaacaaagtcgcttgaaaaacgtatcatgacagcacaaata
cctgtcgtggccgagctcggcacatctgaactgacgatagaagagtttttaagtttagaa
gtcggagactgcataactttggacaaatcagtcacggatcctcttactgtattggtcgga
gataagccgaaatttttaggacaagccggccgggtgaatcgaaaacaggcagtgcaaatt
ttagatcacgacataagaggtgaacaagatggagaataa

DBGET integrated database retrieval system