KEGG   Bacillus subtilis subsp. subtilis 168: BSU16320
Entry
BSU16320          CDS       T00010                                 

Gene name
fliY
Definition
(RefSeq) flagellar motor switch phosphatase FliY
  KO
K02417  flagellar motor switch protein FliN
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02030  Bacterial chemotaxis
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU16320 (fliY)
   02040 Flagellar assembly
    BSU16320 (fliY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU16320 (fliY)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16320 (fliY)
Secretion system [BR:bsu02044]
 Type III secretion system
  Flagellar export apparatus
   BSU16320 (fliY)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   C ring
    BSU16320 (fliY)
SSDB
Motif
Pfam: CheC FliMN_C CheX FliM
Other DBs
NCBI-GeneID: 936421
NCBI-ProteinID: NP_389514
Pasteur: BG10252
BSORF: BG10252
UniProt: P24073 A0A6M3ZBF8
Position
1702672..1703808
AA seq 378 aa
MENNRLSQDEIDALLNGTGSTLDEPEIPEVDDLSEMERDAIGEIGNISFGSSATALSTLL
NQKVDITTPSVTVIPRSKISDAFPEPYVAIEVNYTEGFSGSNLLVVEQSDAAIIADLMIG
GDGKGADPSLGEIHLSAVQEAMNQMMGSAATSMSTVFSKKIDISPPRVELLDVTEEKGTD
RIPDDEMLVKVSFNLKVGELIDSSIMQLYPLTFAKDLISSLMNSESAEEEETVQPEVTYE
QPKEPVTPEPRIEPKQQQQPPKRQGTAKKAAPVQVSPVEFSAFDPNEAVQAPIHNLDMLL
DIPLSITVELGRTKRSVKEILELSAGSIIELDKLAGEPVDILVNQRIVAKGEVVVIEENF
GVRVTDILSQAERINNLK
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggagaataatagattatctcaagatgagattgacgcgcttcttaacggtactggcagc
acgcttgatgagccagagattccggaagtagatgacttatcggaaatggagcgtgatgcg
atcggtgaaatcggtaatatttcattcggcagttctgcgacagcactgtcaacgctttta
aatcaaaaggtcgatattacgactccaagcgtaacggtcattccaagaagtaaaatcagc
gatgcgtttcctgaaccgtatgtagcgattgaagtgaattatacggagggcttcagcgga
agcaacctgttagtcgtggaacaaagtgacgcggcgatcattgcggacttaatgatcggg
ggagacggaaaaggtgcggacccttcactgggtgaaatccatttaagtgcggttcaagaa
gcaatgaaccaaatgatgggatcggctgccacatcaatgtctactgtattcagtaaaaaa
attgatatttcacctcctcgggttgaattgctggatgttactgaagaaaagggtacagac
cgtattcctgatgatgaaatgctggtgaaagtttctttcaacttaaaggtgggagaatta
atagactccagcattatgcaactttacccattgacatttgcgaaagatttaatttcaagc
cttatgaactcagaaagtgcagaggaagaagaaacggtgcagcctgaagttacatacgaa
cagccgaaagagcctgtgacgccagagccgcgtattgaaccgaagcaacagcagcagccg
ccaaaaaggcagggaacagcaaaaaaagcagcgccagttcaggtttcaccggtggaattt
tccgcgtttgatccaaacgaagctgtacaagcccctattcataatctggatatgcttttg
gatatcccgctttcgattactgttgagcttggcagaacgaagagaagcgtaaaagagatt
ttagagctttctgccggaagtattatcgagcttgataaattagccggtgagcctgtagat
attttagttaatcagcgtatcgttgccaaaggcgaggtcgttgtcattgaagaaaacttc
ggagtgagagtcactgacattttaagccaggcagagcgcattaataatttaaaataa

DBGET integrated database retrieval system