KEGG   Bacillus subtilis subsp. subtilis 168: BSU16330
Entry
BSU16330          CDS       T00010                                 

Gene name
cheY
Definition
(RefSeq) chemotaxis protein CheY
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU16330 (cheY)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU16330 (cheY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU16330 (cheY)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16330 (cheY)
Two-component system [BR:bsu02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   BSU16330 (cheY)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BSU16330 (cheY)
SSDB
Motif
Pfam: Response_reg B12-binding
Other DBs
NCBI-GeneID: 940120
NCBI-ProteinID: NP_389515
Pasteur: BG10258
BSORF: BG10258
UniProt: P24072 A0A6M4JGE2
Position
1703834..1704196
AA seq 120 aa
MAHRILIVDDAAFMRMMIKDILVKNGFEVVAEAENGAQAVEKYKEHSPDLVTMDITMPEM
DGITALKEIKQIDAQARIIMCSAMGQQSMVIDAIQAGAKDFIVKPFQADRVLEAINKTLN
NT seq 363 nt   +upstreamnt  +downstreamnt
atggcacatagaattttaattgtagatgacgcagcatttatgcgaatgatgattaaagat
attttggttaaaaatggttttgaagttgtggcggaagctgaaaatggagcacaagcggta
gagaaatataaagagcattcacctgaccttgttactatggatatcacgatgccagaaatg
gatggtattacagcattaaaagaaattaaacaaattgatgcgcaggcaagaatcatcatg
tgttctgctatgggacagcaatcaatggttattgatgccattcaggccggcgctaaggat
ttcattgtgaaacctttccaggctgaccgtgtgcttgaagcaatcaacaaaacattaaat
taa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU17940
Entry
BSU17940          CDS       T00010                                 

Gene name
yneI
Definition
(RefSeq) plasmid maintenance protein CcdB
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU17940 (yneI)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU17940 (yneI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU17940 (yneI)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU17940 (yneI)
Two-component system [BR:bsu02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   BSU17940 (yneI)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BSU17940 (yneI)
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-GeneID: 939468
NCBI-ProteinID: NP_389677
Pasteur: BG11250
BSORF: BG11250
UniProt: P45709 A0A6M3ZBG5
Position
1924030..1924392
AA seq 120 aa
MTRVLVVDDAKFMRVKIREILEEANYIIAGEAADGEQAADLYKKLRPDLVTMDITMPVKN
GIKALRDILTFDPKAKVIMCTAMRQQRIVTEAIELGAKDFIVKPFEETKVLEAVSRVMGH
NT seq 363 nt   +upstreamnt  +downstreamnt
atgacaagagttttagttgtagacgacgccaagttcatgagagtgaaaatcagagagatc
ttggaagaggcaaattacataatcgcaggcgaagcggcggacggtgaacaagcagctgac
ctgtataaaaaactgcgcccggaccttgtgacaatggatattacaatgccggtgaaaaac
ggcataaaagcgcttcgtgatatcttaacctttgatcctaaagcgaaggtcatcatgtgc
accgccatgcgccagcaaagaattgtaacggaagcaattgagctgggggcaaaggatttt
attgttaagccgtttgaggaaacaaaagtgctggaagctgtaagccgcgttatgggacat
taa

DBGET integrated database retrieval system