KEGG   Bacillus subtilis subsp. subtilis 168: BSU16370
Entry
BSU16370          CDS       T00010                                 

Symbol
fliR
Name
(RefSeq) flagellar biosynthetic protein FliR
  KO
K02421  flagellar biosynthesis protein FliR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16370 (fliR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU16370 (fliR)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16370 (fliR)
Secretion system [BR:bsu02044]
 Type III secretion system
  Flagellar export apparatus
   BSU16370 (fliR)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    BSU16370 (fliR)
SSDB
Motif
Pfam: Bac_export_1 Ac110_PIF
Other DBs
NCBI-GeneID: 940130
NCBI-ProteinID: NP_389519
Pasteur: BG10262
BSORF: BG10262
UniProt: P35537 A0A6M3ZAT4
Position
1705820..1706599
AA seq 259 aa
MNSIIDLFPAFLLVFIRISAFFVTIPLFGHRNVPAVHRIGFAFFLAVICFSTIDKPPSLE
IDEHYMLLAFKEALVGLCLGLIAYMMIAAVQIAGSFIDFQMGFSIANVIDPQTGAQSPLI
GQFIYTMALLFMLSVNAHHLLLDGIYYSFQYISVDQAFPNFGDEKFAYFIAKSFNAMFII
AFQMSAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMSVIFVVVRN
VFSLTIETMRNLLALVGVS
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaattcaattattgacttatttcctgcttttttattggtttttattagaatctctgct
ttttttgtaacgattccgctatttggacatcgaaatgtgccagctgttcatcgcataggt
tttgctttttttcttgcggtcatttgtttcagcaccattgataaaccgccctctttggag
atagatgagcactatatgcttttggcgtttaaagaagctttggtcggcctatgtctgggt
ttaattgcttatatgatgattgccgcagtgcagattgccggctcgtttattgattttcaa
atgggattttcaatagcaaacgttattgatccgcaaaccggtgcacaaagtccgttgatt
ggccagtttatctatacgatggcacttttgtttatgctgagtgtcaatgcccaccatttg
ttgctggatggtatttactacagctttcagtatatttcagttgatcaggcatttccgaat
ttcggcgatgaaaagtttgcctattttattgcgaaaagctttaatgcaatgtttattatc
gcttttcaaatgtcagcgccggttgtggccagtttgtttctagttgatttagcattaggt
atcgtggctcgaactgttccgcagttaaatgtatttgtggtcggtctgcctttaaagatc
gctgtcagtttcattatgctcattgtatgtatgtccgttatcttcgtcgttgtccggaat
gttttcagtttaacgattgaaacgatgcggaatcttttagcattggtcggtgtttcttaa

DBGET integrated database retrieval system