KEGG   Bacillus subtilis subsp. subtilis 168: BSU16430
Entry
BSU16430          CDS       T00010                                 

Symbol
cheA
Name
(RefSeq) chemotaxis protein CheA
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU16430 (cheA)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU16430 (cheA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU16430 (cheA)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU16430 (cheA)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16430 (cheA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU16430 (cheA)
Protein kinases [BR:bsu01001]
 Histidine kinases
  CheA family [OT]
   BSU16430 (cheA)
Two-component system [BR:bsu02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   BSU16430 (cheA)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BSU16430 (cheA)
SSDB
Motif
Pfam: CheW P2 Hpt HATPase_c H-kinase_dim DUF3391 HATPase_c_3
Other DBs
NCBI-GeneID: 939600
NCBI-ProteinID: NP_389525
Pasteur: BG10256
BSORF: BG10256
UniProt: P29072 A0A6M3ZBG8
Position
1712815..1714833
AA seq 672 aa
MDMNQYLDVFIDESKEHLQTCNEKLLLLEKDPTDLQLVHDIFRAAHTLKGMSATMGYTDL
AHLTHLLENVLDAIRNGDMEVTSDWLDILFEALDHLETMVQSIIDGGDGKRDISEVSAKL
DVNGAHAESAASAEPAEAQSSASDWEYDEFERTVIQEAEEQGFKRYEIKISLNENCMLKA
VRVYMVFEKLNEVGEVAKTIPSAEVLETEDFGTDFQVCFLTHQSAEDIEQLINGVSEIEH
VEVIQGAPLTSAEKPEESKQEDSPAAAVPAKQEKQKQPAKNDEQAKHSAGGSKTIRVNID
RLDSLMNLFEELVIDRGRLEQIAKELEHNELTETVERMTRISGDLQSIILNMRMVPVETV
FNRFPRMIRQLQKELNKKIELSIIGAETELDRTVIDEIGDPLVHLIRNSIDHGIEAPETR
LQKGKPESGKVVLKAYHSGNHVFIEVEDDGAGLNRKKILEKALERGVITEKEAETLEDNQ
IYELIFAPGFSTADQISDISGRGVGLDVVKNKLESLGGSVSVKSAEGQGSLFSIQLPLTL
SIISVLLIKLEEETFAIPISSIIETAVIDRKDILQTHDREVIDFRGHIVPVVYLKEEFKI
EDTRKDAEQLHIIVVKKGDKPTAFVVDSFIGQQEVVLKSLGDYLTNVFAISGATILGDGE
VALIIDCNALII
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggatatgaatcagtatttagatgtctttattgatgagagtaaagaacatttacaaaca
tgtaatgaaaagcttcttcttttagagaaagacccgactgatcttcagctcgtacatgat
atattcagggctgcccatacattaaaaggaatgagcgcaacgatgggctacacggattta
gcacatcttacccatctgcttgaaaacgtgctggatgcaatccgaaacggagacatggaa
gtcacctcagactggctggatattttgtttgaagctctggatcacctggaaacaatggtt
cagtctattattgatggcggggatggtaaaagagatatctcagaagtgagtgccaagctt
gatgtgaatggtgcgcacgctgaatccgctgcctccgctgaacctgcagaagcacagagt
tcagcatctgattgggaatatgatgaatttgaacgcacagttatacaagaagcggaggag
caaggcttcaaacgatatgaaatcaagatttctctgaacgaaaactgtatgttaaaagca
gttcgtgtctatatggtgtttgaaaaactaaatgaagtcggagaagtagccaaaacaatt
ccaagtgctgaagtgcttgaaacagaagattttggaactgactttcaagtttgtttctta
acacatcaatcagcggaagacattgaacaattaatcaatggcgtgtcggaaattgagcat
gttgaagtcattcaaggggctcctttaacatcagctgaaaagcctgaagaatctaagcaa
gaagattcaccagcagcagctgtacctgcgaagcaggagaaacaaaaacagcctgctaaa
aacgatgaacaggcgaagcattcagccggcggatctaaaacaattcgtgtcaacattgac
aggcttgattctttaatgaacttatttgaagagcttgtcattgaccgcgggcgtctcgag
cagattgcgaaagagcttgagcataatgaactgactgaaacggttgaacgaatgacgaga
atttccggagatttgcaatcgattattctgaatatgagaatggtcccggttgaaactgtt
tttaacagattcccgagaatgattcgccagcttcagaaagagctgaataaaaaaattgaa
ctctcgatcatcggtgcggaaactgaactggatcgtacagtaattgatgaaatcggagat
ccactcgttcacttgatcagaaacagtattgaccatggtatcgaggcgccggaaacacgt
ttgcaaaagggaaaaccggaatcaggaaaagttgtgcttaaagcttatcacagcggcaac
catgtctttatcgaagtagaggatgacggcgcaggccttaatcgaaaaaaaattctggaa
aaagcgcttgagcgcggggtcataacggaaaaagaagctgaaaccttagaagacaaccaa
atttacgaattgatttttgctccggggttctcaactgctgaccaaatttctgatatttcc
ggccgcggtgtaggacttgacgttgtaaaaaacaaactggagtctcttggcggttcagtc
agtgtgaaatcagccgagggtcaaggctctctattcagcatccagctgccgcttaccttg
tctattatttcagttctgctgattaagttggaagaagagacatttgccattccgatttct
tcaatcattgagacagcagttattgacagaaaagacattttgcaaacgcatgaccgtgaa
gtgattgactttagagggcatattgtccctgtcgtttatttaaaagaagagtttaaaata
gaagatacaagaaaagatgcggaacagctccatatcattgtcgtgaaaaaaggcgacaaa
cctactgcatttgtggtggactcctttattggccagcaggaagttgtgctgaaatcactc
ggagattatttaacaaacgtctttgcaatttccggagctactattttaggagacggagaa
gtagcgctcattattgattgtaatgcactgattatttaa

DBGET integrated database retrieval system