KEGG   Bacillus subtilis subsp. subtilis 168: BSU16440
Entry
BSU16440          CDS       T00010                                 

Gene name
cheW
Definition
(RefSeq) chemotaxis protein CheW
  KO
K03408  purine-binding chemotaxis protein CheW
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU16440 (cheW)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU16440 (cheW)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16440 (cheW)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BSU16440 (cheW)
SSDB
Motif
Pfam: CheW
Other DBs
NCBI-GeneID: 939957
NCBI-ProteinID: NP_389526
Pasteur: BG10692
BSORF: BG10692
UniProt: P39802 A0A6M4JIA9
Position
1714855..1715325
AA seq 156 aa
MTAEIKTGEKMIVFMVNGKEYAISVTQVKSIEKWQKPTRVPGVEPYICGVINLRGVVTPV
IDLRKRLNLPEYEITDETRIIIIAYRDIEVGWIVDEANDVITVHESEIESAPEGVQKDTD
VSIEQIVKQENRLLNIIDANAVLDKESSQSAVPDQA
NT seq 471 nt   +upstreamnt  +downstreamnt
atgactgcagaaattaaaacaggcgaaaaaatgatagtctttatggtaaatggcaaagaa
tatgccatttccgtcactcaggtgaaatcaattgaaaaatggcaaaagccaacgagggta
cctggcgtcgaaccatatatttgcggggtaatcaatttacgcggggtggtgactccggtt
attgatttaagaaaacgcctgaatttgccagagtatgaaattacagatgaaacacgaatt
atcattattgcttatcgtgatattgaagtcggctggattgtggatgaagcgaatgatgtg
attaccgtacacgaaagtgaaatagaatctgctccagaaggcgttcagaaagatacggat
gtgtcgatcgaacagattgtgaaacaagagaacagactcttaaatattattgatgcgaac
gcggttttggataaagaatcatctcagtccgctgtgcccgatcaagcttaa

DBGET integrated database retrieval system